RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAD35944.1 tmar0 AAD35944.1 GIB00025CH01 "glucose-1-phosphate
thymidylyltransferase"
         (355 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00483 NTP_transferase "Nucleotidyl transferase"                     161   1e-42
PF01128 IspD "Uncharacterized protein family UPF0007"                  45   1e-07
PF07959 Fucokinase "L-fucokinase"                                      35   1e-04

>PF00483 NTP_transferase "Nucleotidyl transferase"
          Length = 238

 Score =  161 bits (409), Expect = 1e-42
 Identities = 90/221 (40%), Positives = 141/221 (63%), Gaps = 7/221 (3%)

Query: 4   AIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFK 63
           A++L  G GTRLRPLT    K L+P+  KP++ Y+LE +A AGIEE+ +VV+ ++ E  +
Sbjct: 2   AVILAGGLGTRLRPLTRERPKKLLPVGGKPLIQYTLERLAAAGIEEIIVVVTGYHKESIE 61

Query: 64  SIVGTGENFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYL--GDNLILEDLGKFVK 121
             +G G   G+ I+Y++Q EP G AHAV ++ +F+GDE F++ +  GD+LI +D  + ++
Sbjct: 62  EHLGDGYELGVEITYVLQPEPLGTAHAVLLAADFIGDEPFVVLVLPGDHLIDDDFAELLE 121

Query: 122 DFE--NSDYAASILLSPVKDPTRFGVAVMEGD-RVIKVVEKPKT-PPSNLAIVGLYLFRN 177
                 +D   ++ + PV+DPT +GV   + D RV + VEKP     SNLA  G+Y+F  
Sbjct: 122 AHRETGADGLVTVGIVPVEDPTGYGVIERDEDGRVTRFVEKPDAETASNLANTGIYVFNP 181

Query: 178 KIFEG-IKNIKPSWRGELEITDAIEYLIEKGEKVRGYIVYG 217
            IF+  ++ ++P  RGE E+TDAI  L+E+G+ V  Y+  G
Sbjct: 182 GIFDFLLELLEPLARGEPELTDAIPALLEEGKVVVAYLFRG 222


>PF01128 IspD "Uncharacterized protein family UPF0007"
          Length = 222

 Score = 45.5 bits (107), Expect = 1e-07
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 17/157 (10%)

Query: 4   AIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLEN-IARAGIEEVGIVVSPHNAEEF 62
           AI+L AG G+R+        K  + +  KPIL ++LE  +A   I+E+ +VVSP + E F
Sbjct: 3   AIILAAGSGSRMGA---GLPKQYLELGGKPILEHTLEAFLAHPAIDEIVVVVSPDDIEYF 59

Query: 63  KSIVGTGENFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDN---LILEDLGKF 119
           + ++G    +  R+  +++   +     +       GD D+++        +  ED+ + 
Sbjct: 60  EELLG---KYDKRVK-VVEGGAERQDSVLNGLAALAGDADWVLVHDAARPFVTPEDIDRL 115

Query: 120 VKDFENSDYAASILLSPVKDPTRF----GVAVMEGDR 152
           +   E  +Y A+IL  PVKD  +     GV V   DR
Sbjct: 116 IAAAE--EYGAAILAVPVKDTIKRVDADGVVVETVDR 150


>PF07959 Fucokinase "L-fucokinase"
          Length = 394

 Score = 35.4 bits (81), Expect = 1e-04
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 251 SSIQGPVRIGKASKIVNSVIRGPAVIGENCFIKNSYVGPYSSIGNRVILEDCEVENSIVM 310
           SS   P  +   S ++NS++ G   +G    ++ S++G   SIG+R I+   +V  S ++
Sbjct: 251 SSPATPCDVAATSVVINSILEGGVSVGPGSVVEYSHLGGGVSIGSRCIVSGVDVNASTLL 310


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.322    0.143    0.405 

Gapped
Lambda     K      H
   0.267   0.0439    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 11,844,477
Number of extensions: 661552
Number of successful extensions: 89649
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2162
Number of HSP's successfully gapped: 241
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)