RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAD36465.1 tmar0 AAD36465.1 GIB00025CH01 "conserved
hypothetical protein"
         (290 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01430 HSP33 "Hsp33 protein"                                         182   5e-49

>PF01430 HSP33 "Hsp33 protein"
          Length = 277

 Score =  182 bits (463), Expect = 5e-49
 Identities = 113/269 (42%), Positives = 159/269 (59%), Gaps = 8/269 (2%)

Query: 9   DHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNG 68
           D  VR   VR+ E V+EA  RH      T +LG AL   AL+   L    R TL I+G+G
Sbjct: 10  DGDVRGEAVRLTETVQEALKRHDYPPPVTALLGEALAATALLGATLKFDGRLTLQIQGDG 69

Query: 69  PIRRVVAQSTSEFTVRGYV-ANPKVELP-LNEKGKFDVAGAIGQGVLRVVRDLGLKTPFV 126
           P+  +V  + ++  VRGY   NP+V+LP L   G  DV   +G G L V +D GL  P+ 
Sbjct: 70  PVGLIVVDADADGEVRGYARGNPEVDLPPLAPDG--DVGELVGNGYLAVTKDPGLGEPYQ 127

Query: 127 SQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSD-GVKIAGGFAVQIIDRTLEQEKV 185
             VPL  GEIAEDL +YFA SEQ+P+   +GVLVD D GVK AGG  +Q++    ++E  
Sbjct: 128 GIVPLEGGEIAEDLEHYFAQSEQLPTRVGLGVLVDEDNGVKRAGGLLLQVLPGA-DEEDW 186

Query: 186 EMIEKNIKNLPSISKLFQEAEPLDVLERIFGEK-VGFVETAEIKYKCDCNREKAKNALLV 244
           E +E  ++ L S   L     P ++L R+F E+ V  +E   ++++C C+RE+  +ALL 
Sbjct: 187 ERLETLLETLISEELLDPGLSPEELLYRLFHEEDVRILEPQPVRFRCTCSRERVADALLS 246

Query: 245 LDKKELEDM-RKEGKGEVVCKWCNTRYVF 272
           L K+ELEDM  ++GK EV C++C  +Y F
Sbjct: 247 LGKEELEDMIEEDGKIEVTCEFCGKKYHF 275


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.321    0.137    0.385 

Gapped
Lambda     K      H
   0.267   0.0559    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 18,113,166
Number of extensions: 1062621
Number of successful extensions: 135036
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3619
Number of HSP's successfully gapped: 241
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)