RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAD36835.1 tmar0 AAD36835.1 GIB00025CH01 "conserved
hypothetical protein"
         (497 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF02734 Dak2 "DAK2 domain"                                             80   8e-18
PF07882 Fucose_iso_N2 "L-fucose isomerase, second N-terminal dom...    33   8e-04

>PF02734 Dak2 "DAK2 domain"
          Length = 173

 Score = 79.8 bits (196), Expect = 8e-18
 Identities = 65/172 (37%), Positives = 83/172 (48%), Gaps = 13/172 (7%)

Query: 4   VPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMA 63
           V DGDTG+NM      A + +D++   D+ EV KA+    L GA GNSGV+L Q  RG A
Sbjct: 1   VGDGDTGTNMARGFRAALEALDDLPLADIGEVLKAIAMALLSGAGGNSGVLLGQFFRGAA 60

Query: 64  DA-SPREYITPADFVKMISNARKVAYSAV--MRPVEGTMLTVVRVLDERL-QGKNFETFE 119
            A   +E +T AD    +  A   A  AV   +P + TML V+R   E L + K+ E   
Sbjct: 61  KALKGKEELTAADLAAALQAALD-AVQAVGGAKPGDKTMLDVLRPAAEALEEAKDGEDLA 119

Query: 120 ELFDWIVEIARDTVNRTPHMLQKL--------REAGVVDAGAKGLYYIFEGM 163
           E  +   E A      T  ML  L        R  GVVD GA GL  I E +
Sbjct: 120 EALEAAAEAAEAGAESTKDMLAVLGRASYVGERSLGVVDPGAVGLALILEAL 171


>PF07882 Fucose_iso_N2 "L-fucose isomerase, second N-terminal
           domain"
          Length = 180

 Score = 33.2 bits (75), Expect = 8e-04
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 92  MRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHMLQKLREAGVVDA 151
           MR     M  +VR +DE +  +  E FE+   W+ E  ++  ++ P  LQ+ RE    DA
Sbjct: 29  MRVESVDMTEIVRRIDEGIYDE--EEFEKALAWLEENCKEGDDKNPEDLQRQREQ--KDA 84

Query: 152 GAKGLYYIFEGMRDAVKGN 170
             +    ++  +RD ++GN
Sbjct: 85  QWEFSIKMYLAIRDIMEGN 103


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.322    0.138    0.387 

Gapped
Lambda     K      H
   0.267   0.0543    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 17,752,840
Number of extensions: 1020308
Number of successful extensions: 128709
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3034
Number of HSP's successfully gapped: 224
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)