RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAD36879.1 tmar0 AAD36879.1 GIB00025CH01 "conserved
hypothetical protein"
         (124 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1o13A [c.55.5.1] PROBABLE NIFB PROTEIN                                138   5e-36
1eo1A [c.55.5.1] HYPOTHETICAL PROTEIN MTH1175                          94   2e-22

>1o13A [c.55.5.1] PROBABLE NIFB PROTEIN
          Length = 107

 Score =  138 bits (350), Expect = 5e-36
 Identities = 105/106 (99%), Positives = 105/106 (99%)

Query: 2   IIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVK 61
           IIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVK
Sbjct: 2   IIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVK 61

Query: 62  EKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQ 107
           EKGAELVIVRGIGRRAIAAFEA GVKVIKGASGTVEEVVNQYLSGQ
Sbjct: 62  EKGAELVIVRGIGRRAIAAFEAXGVKVIKGASGTVEEVVNQYLSGQ 107


>1eo1A [c.55.5.1] HYPOTHETICAL PROTEIN MTH1175
          Length = 124

 Score = 93.5 bits (232), Expect = 2e-22
 Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 3/112 (2%)

Query: 1   MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHG--AVPN 58
           M IAI  S      S +S  FGRAPYF  V++K   I    V ENP A            
Sbjct: 1   MKIAIASSGT-DLGSEVSRFFGRAPYFMIVEMKKGNIESSEVIENPSASASGGAGIRTAQ 59

Query: 59  FVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKD 110
            +   G + VI    G  A      +G+K+ +    +VEE +  +  G L++
Sbjct: 60  IIANNGVKAVIASSPGPNAFEVLNELGIKIYRATGTSVEENLKLFTEGNLEE 111


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.316    0.135    0.373 

Gapped
Lambda     K      H
   0.267   0.0448    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,372,462
Number of extensions: 1182571
Number of successful extensions: 6654
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6373
Number of HSP's successfully gapped: 205
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)