BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS80854.1 tthe0 AAS80854.1 GIB00176CH01 "ribosome recycling
factor (rrf)"
         (185 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1eh1A [d.67.3] RIBOSOME RECYCLING FACTOR                              332   5e-94
1is1A [d.67.3] RIBOSOME RECYCLING FACTOR                              172   7e-46
1dd5A [d.67.3] RIBOSOME RECYCLING FACTOR                              159   6e-42
1iseA [d.67.3] RIBOSOME RECYCLING FACTOR                              147   2e-38
1wqgA [x.x.x] RIBOSOME RECYCLING FACTOR                               143   5e-37
1wqfA [x.x.x] RIBOSOME RECYCLING FACTOR                               143   5e-37
1ek8A [d.67.3] RIBOSOME RECYCLING FACTOR                              131   2e-33
1ge9A [d.67.3] RIBOSOME RECYCLING FACTOR                              112   7e-28
1wihA [d.67.3] MITOCHONDRIAL RIBOSOME RECYCLING FACTOR                 39   9e-06
1y698 [x.x.x] RIBOSOME RECYCLING FACTOR                                36   8e-05

>1eh1A [d.67.3] RIBOSOME RECYCLING FACTOR
          Length = 185

 Score =  332 bits (851), Expect = 5e-94
 Identities = 185/185 (100%), Positives = 185/185 (100%)

Query: 1   MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTA 60
           MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTA
Sbjct: 1   MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTA 60

Query: 61  PDPRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQ 120
           PDPRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQ
Sbjct: 61  PDPRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQ 120

Query: 121 YAEEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKE 180
           YAEEGRVAIRNIRR             HLSEDETKRAEAEIQKITDEFIAKADQLAEKKE
Sbjct: 121 YAEEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKE 180

Query: 181 QEILG 185
           QEILG
Sbjct: 181 QEILG 185


>1is1A [d.67.3] RIBOSOME RECYCLING FACTOR
          Length = 185

 Score =  172 bits (436), Expect = 7e-46
 Identities = 87/182 (47%), Positives = 122/182 (67%)

Query: 3   LKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPD 62
           + E+  + +  M KS+E L++NL+ +RTGRA+P+LL  + VEYYGA  PLNQ+A V A D
Sbjct: 2   INEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAED 61

Query: 63  PRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYA 122
            RTL +  +D+   + +EKAI  SDLGLNP + G  + + +PPLTEERRKDLV+ VR  A
Sbjct: 62  ARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEA 121

Query: 123 EEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQE 182
           E GRVA+RNIRR              +SEDE ++A+ EIQK+TD  + K D++   KE+E
Sbjct: 122 EGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKE 181

Query: 183 IL 184
           ++
Sbjct: 182 LM 183


>1dd5A [d.67.3] RIBOSOME RECYCLING FACTOR
          Length = 184

 Score =  159 bits (402), Expect = 6e-42
 Identities = 78/176 (44%), Positives = 116/176 (65%)

Query: 9   ETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVV 68
           E +  M+++LE +E  L  +RTG+ +PA+L  +KV+YYG   P+NQ+AT++  + RTLV+
Sbjct: 7   EAKEKMKRTLEKIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISISEERTLVI 66

Query: 69  QSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVA 128
           + WD++ L  IEKAI  SDLGLNP N G+ + +  P  T E+R+  V+  ++  EEG++A
Sbjct: 67  KPWDKSVLSLIEKAINASDLGLNPINDGNVIRLVFPSPTTEQREKWVKKAKEIVEEGKIA 126

Query: 129 IRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEIL 184
           IRNIRR              + ED+ KR E EIQK+TDEFI K D++ E K++EI+
Sbjct: 127 IRNIRREILKKIKEDQKEGLIPEDDAKRLENEIQKLTDEFIEKLDEVFEIKKEEIM 182


>1iseA [d.67.3] RIBOSOME RECYCLING FACTOR
          Length = 184

 Score =  147 bits (372), Expect = 2e-38
 Identities = 74/182 (40%), Positives = 113/182 (62%)

Query: 3   LKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPD 62
           + ++  +    M K +E  +  ++ +RTGRA+P+LL  + VEYYG   PL Q+A+VT  D
Sbjct: 1   ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVED 60

Query: 63  PRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYA 122
            RTL +  +D++   A+EKAI  SDLGLNP++ G  + + +PPLTEERRKDL + VR  A
Sbjct: 61  SRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEA 120

Query: 123 EEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQE 182
           E+ RVA+RN+ R              +SED+ +R++ ++QK+TD  I K +     KE E
Sbjct: 121 EQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAE 180

Query: 183 IL 184
           ++
Sbjct: 181 LM 182


>1wqgA [x.x.x] RIBOSOME RECYCLING FACTOR
          Length = 184

 Score =  143 bits (360), Expect = 5e-37
 Identities = 65/161 (40%), Positives = 105/161 (65%)

Query: 24  NLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSWDQNALKAIEKAI 83
           +L+ +RTGRANP +   + ++YYGA  P+ Q+A++  P+ R +V++ ++ N L+AIE AI
Sbjct: 22  DLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAI 81

Query: 84  RDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRRXXXXXXXXX 143
           R+SDLG+NP+N G  + + +P LTEERR++LV+  +   EE +V++RNIRR         
Sbjct: 82  RNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRI 141

Query: 144 XXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEIL 184
                  EDE  RAE ++ K T +++ + D+L + KE E+L
Sbjct: 142 RKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELL 182


>1wqfA [x.x.x] RIBOSOME RECYCLING FACTOR
          Length = 183

 Score =  143 bits (360), Expect = 5e-37
 Identities = 65/161 (40%), Positives = 105/161 (65%)

Query: 24  NLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSWDQNALKAIEKAI 83
           +L+ +RTGRANP +   + ++YYGA  P+ Q+A++  P+ R +V++ ++ N L+AIE AI
Sbjct: 22  DLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAI 81

Query: 84  RDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRRXXXXXXXXX 143
           R+SDLG+NP+N G  + + +P LTEERR++LV+  +   EE +V++RNIRR         
Sbjct: 82  RNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRI 141

Query: 144 XXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEIL 184
                  EDE  RAE ++ K T +++ + D+L + KE E+L
Sbjct: 142 RKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELL 182


>1ek8A [d.67.3] RIBOSOME RECYCLING FACTOR
          Length = 185

 Score =  131 bits (329), Expect = 2e-33
 Identities = 72/182 (39%), Positives = 109/182 (59%)

Query: 3   LKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPD 62
           + ++  +    M K +E  +  ++ +RTGRA+P+LL  + VEYYG   PL Q+A+VT  D
Sbjct: 2   ISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVED 61

Query: 63  PRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYA 122
            RTL +  +D++   A+EKAI  SDLGLNP++ G  + + +PPLTEERRKDL + VR  A
Sbjct: 62  SRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEA 121

Query: 123 EEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQE 182
           E+                        +SED+ +R++ ++QK+TD  I K +     KE E
Sbjct: 122 EQXXXXXXXXXXXXXXKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAE 181

Query: 183 IL 184
           ++
Sbjct: 182 LM 183


>1ge9A [d.67.3] RIBOSOME RECYCLING FACTOR
          Length = 184

 Score =  112 bits (281), Expect = 7e-28
 Identities = 64/182 (35%), Positives = 104/182 (57%), Gaps = 4/182 (2%)

Query: 3   LKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPD 62
           L++++ E    M+K++E  ++ +AGLRT RA+ AL+  +KVEYYG+ VP+ Q+ T++ P+
Sbjct: 5   LEDIFKEAEKDMKKAVEYYKNEIAGLRTSRASTALVEEIKVEYYGSKVPIKQLGTISVPE 64

Query: 63  PRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYA 122
              +V+Q WDQNA+ AIEKAIR+ +L LNP+ +G+ + +                  +  
Sbjct: 65  HNQIVIQVWDQNAVPAIEKAIRE-ELNLNPTVQGNVIRVXXXXXXXXXXXXXXXXXHKIT 123

Query: 123 EEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQE 182
                                     +SEDE KRA   +QK+TD++I + ++L E KE+E
Sbjct: 124 XXXXXXXXXXXXXXKEMIEELEG---ISEDEKKRALERLQKLTDKYIDEINKLMEAKEKE 180

Query: 183 IL 184
           I+
Sbjct: 181 IM 182


>1wihA [d.67.3] MITOCHONDRIAL RIBOSOME RECYCLING FACTOR
          Length = 84

 Score = 39.3 bits (90), Expect = 9e-06
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 31  GRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQ--SWDQNALKAIEKAIRDSDL 88
           G +  + L H+ V      V LNQI  ++   P+ ++V   S+ +    AI KAIR+S +
Sbjct: 1   GSSGSSGLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAAI-KAIRESGM 59

Query: 89  GLNPSNKGDALYINIPPLT 107
            LNP  +G  + + IP +T
Sbjct: 60  NLNPEVEGTLIRVPIPKVT 78


>1y698 [x.x.x] RIBOSOME RECYCLING FACTOR
          Length = 113

 Score = 36.2 bits (82), Expect = 8e-05
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 112 KDLVRAVRQYAEEGRVAIRNIRRXXXXXXXXXXXXXHLSEDETKRAEAEIQKITDEFIAK 171
           KDL + VR  AE+                        +SED+ +R++ ++QK+TD  I K
Sbjct: 39  KDLTKIVRGEAEQXXXXXXXXXXXXXXKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKK 98

Query: 172 ADQLAEKKEQEIL 184
            +     KE E++
Sbjct: 99  IEAALADKEAELM 111


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.142    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 804,301,606
Number of extensions: 31530785
Number of successful extensions: 77936
Number of sequences better than 1.0e-03: 1718
Number of HSP's gapped: 75374
Number of HSP's successfully gapped: 1890
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)