BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS81141.1 tthe0 AAS81141.1 GIB00176CH01 "amino acid ABC
transporter, ATP-binding protein"
         (244 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2oukB [x.x.x] PROTEIN ARTP                                            301   1e-84
2oljA [x.x.x] AMINO ACID ABC TRANSPORTER                              301   1e-84
1b0uA [c.37.1] HISTIDINE PERMEASE                                     215   1e-58
3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN              175   1e-46
2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN              160   3e-42
2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN            157   2e-41
2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN            157   2e-41
1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK       142   1e-36
1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN       141   2e-36
1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN       141   2e-36
2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN        138   2e-35
3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING          136   7e-35
1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN       135   1e-34
1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING    135   1e-34
3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         135   1e-34
2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         135   1e-34
2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         135   1e-34
2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         134   3e-34
2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         134   3e-34
1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN            120   4e-30
1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN            120   4e-30
2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         117   4e-29
1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN               116   8e-29
2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               116   8e-29
2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               115   2e-28
2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               115   2e-28
3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               115   2e-28
2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING            114   2e-28
3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                         114   3e-28
3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                         114   3e-28
1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN          114   4e-28
1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN          114   4e-28
2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN         113   7e-28
1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BIN...   112   9e-28
1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               112   1e-27
2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               112   1e-27
2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING        108   1e-26
3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC             108   1e-26
3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC             108   1e-26
1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                105   1e-25
1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                104   2e-25
1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID                103   4e-25
1ji0A [c.37.1] ABC TRANSPORTER                                        103   7e-25
2hydA [x.x.x] ABC TRANSPORTER HOMOLOG                                 101   3e-24
3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1                 97   4e-23
2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          96   1e-22
1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA             94   3e-22
1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           89   2e-20
1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING        89   2e-20
1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING        89   2e-20
2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             86   1e-19
2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             86   1e-19
1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN                    83   7e-19
1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1                                81   3e-18
2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            79   1e-17
2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            79   1e-17
2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            79   1e-17
2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            78   2e-17
2ghiA [x.x.x] TRANSPORT PROTEIN                                        78   3e-17
2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            75   2e-16
2ghiC [x.x.x] TRANSPORT PROTEIN                                        74   4e-16
2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         72   2e-15
2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         71   3e-15
2d2fA [x.x.x] SUFC PROTEIN                                             71   3e-15
2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            71   4e-15
2ghiB [x.x.x] TRANSPORT PROTEIN                                        71   4e-15
2d2eA [x.x.x] SUFC PROTEIN                                             70   5e-15
2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  70   6e-15
2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  70   6e-15
2ghiD [x.x.x] TRANSPORT PROTEIN                                        68   2e-14
2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1                68   3e-14
2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  66   9e-14
2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  65   2e-13
3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN                      63   8e-13
2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  62   2e-12
1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA         60   7e-12
3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA         60   7e-12
2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     60   9e-12
1yqtA [x.x.x] RNASE L INHIBITOR                                        59   1e-11
2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               58   3e-11
2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               58   3e-11
2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     57   4e-11
2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066                              56   1e-10
2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          56   1e-10
2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          54   6e-10
2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                53   1e-09
2qi9C [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD              51   4e-09
2ix3A [x.x.x] ELONGATION FACTOR 3                                      51   4e-09
2iwhB [x.x.x] ELONGATION FACTOR 3A                                     51   4e-09
1l7vC [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD          50   5e-09
2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                49   2e-08
1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER                                48   3e-08
1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   4e-08
2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                47   4e-08
2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                47   4e-08
2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                47   4e-08
1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   6e-08
1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   6e-08
1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   6e-08
1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   6e-08
1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               47   8e-08
2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               46   1e-07
2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               46   1e-07
2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             46   1e-07
2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             46   1e-07
2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             46   1e-07
1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               45   2e-07
1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               45   3e-07
2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                45   3e-07
2ix8A [x.x.x] ELONGATION FACTOR 3A                                     45   3e-07
2iw3B [x.x.x] ELONGATION FACTOR 3A                                     45   3e-07
2iw3A [x.x.x] ELONGATION FACTOR 3A                                     45   3e-07
2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                43   1e-06
1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               42   2e-06
2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                42   2e-06
2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                42   2e-06
2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                42   2e-06
1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               41   4e-06
1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               41   4e-06
1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               41   4e-06
2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                39   2e-05
2zyoA [x.x.x] SOLUTE-BINDING PROTEIN                                   35   3e-04
2zynA [x.x.x] SOLUTE-BINDING PROTEIN                                   35   3e-04
2zymA [x.x.x] SOLUTE-BINDING PROTEIN                                   35   3e-04
1ii8B [c.37.1] RAD50 ABC-ATPASE                                        35   3e-04
1f2uD [c.37.1] RAD50 ABC-ATPASE                                        35   3e-04
1f2uB [c.37.1] RAD50 ABC-ATPASE                                        35   3e-04
1f2tB [c.37.1] RAD50 ABC-ATPASE                                        35   3e-04

>2oukB [x.x.x] PROTEIN ARTP
          Length = 241

 Score =  301 bits (771), Expect = 1e-84
 Identities = 153/239 (64%), Positives = 181/239 (75%), Gaps = 1/239 (0%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           +I +  L K FG L VLKGI++ +  GE +V+IGPSGSGKST +R +N LEDF       
Sbjct: 2   MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXX 61

Query: 64  DGLNVK-DDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXX 122
              N+K  D  L +VR EVGMVFQ+FNLFPHMTVL N+TLAPM+VR+WPR          
Sbjct: 62  XXXNLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMEL 121

Query: 123 XXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMR 182
             +VG+ D+A  YP  LSGGQ QRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL VM+
Sbjct: 122 LDKVGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK 181

Query: 183 DLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQRV 241
            LA  GMTMVVVTHEMGFAREV DRV+FMDGG I+EEG+PE++F RP+ ERT++FL +V
Sbjct: 182 QLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQHERTKAFLSKV 240


>2oljA [x.x.x] AMINO ACID ABC TRANSPORTER
          Length = 242

 Score =  301 bits (771), Expect = 1e-84
 Identities = 153/239 (64%), Positives = 181/239 (75%), Gaps = 1/239 (0%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           +I +  L K FG L VLKGI++ +  GE +V+IGPSGSGKST +R +N LEDF       
Sbjct: 3   MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXX 62

Query: 64  DGLNVK-DDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXX 122
              N+K  D  L +VR EVGMVFQ+FNLFPHMTVL N+TLAPM+VR+WPR          
Sbjct: 63  XXXNLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMEL 122

Query: 123 XXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMR 182
             +VG+ D+A  YP  LSGGQ QRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL VM+
Sbjct: 123 LDKVGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK 182

Query: 183 DLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQRV 241
            LA  GMTMVVVTHEMGFAREV DRV+FMDGG I+EEG+PE++F RP+ ERT++FL +V
Sbjct: 183 QLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQHERTKAFLSKV 241


>1b0uA [c.37.1] HISTIDINE PERMEASE
          Length = 258

 Score =  215 bits (547), Expect = 1e-58
 Identities = 119/248 (47%), Positives = 157/248 (63%), Gaps = 13/248 (5%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           + + +LHK +G   VLKG+ L+   G+           KST +R IN LE   EG ++V+
Sbjct: 3   LHVIDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVN 62

Query: 65  GLNVK------------DDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPR 112
           G N+             D   LR +R  + MVFQ FNL+ HMTVLENV  AP++V    +
Sbjct: 63  GQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 122

Query: 113 XXXXXXXXXXXXRVGILDQAR-KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDP 171
                       +VGI ++A+ KYP  LSGGQQQRV+IARALAMEP ++LFDEPTSALDP
Sbjct: 123 HDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDP 182

Query: 172 EMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKE 231
           E+VGEVL +M+ LA+ G TMVVVTHEMGFAR V+  V+F+  G+I EEG PE++F  P+ 
Sbjct: 183 ELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQS 242

Query: 232 ERTRSFLQ 239
            R + FL+
Sbjct: 243 PRLQQFLK 250


>3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
          Length = 343

 Score =  175 bits (443), Expect = 1e-46
 Identities = 97/247 (39%), Positives = 145/247 (58%), Gaps = 8/247 (3%)

Query: 4   IIRIRNLHKWFGP----LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEG 59
           +I++ N+ K F      +  L  + L V  G+   +IG SG+GKSTLIR +N LE   EG
Sbjct: 1   MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60

Query: 60  EVVVDG--LNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXX 117
            V+VDG  L    +  L + RR++GM+FQ FNL    TV  NV L P+ +   P+     
Sbjct: 61  SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL-PLELDNTPKDEVKR 119

Query: 118 XXXXXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEV 177
                   VG+ D+   YP+ LSGGQ+QRVAIARALA  PK++L DE TSALDP     +
Sbjct: 120 RVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSI 179

Query: 178 LDVMRDLAQG-GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRS 236
           L++++D+ +  G+T++++THEM   + + D V  +  G+++E+    E+F+ PK    + 
Sbjct: 180 LELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQK 239

Query: 237 FLQRVLH 243
           F+Q  LH
Sbjct: 240 FIQSTLH 246


>2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 358

 Score =  160 bits (406), Expect = 3e-42
 Identities = 93/240 (38%), Positives = 137/240 (57%), Gaps = 11/240 (4%)

Query: 3   PIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVV 62
           P IR+ NL K+FG +  + G+  EV  GE + ++GPSG GK+T +  +  +     GE+ 
Sbjct: 1   PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIY 60

Query: 63  VDGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXX 122
            D + V D   +    REVGMVFQ + L+PHMTV EN+   P+R RR  +          
Sbjct: 61  FDDVLVND---IPPKYREVGMVFQNYALYPHMTVFENIAF-PLRARRISKDEVEKRVVEI 116

Query: 123 XXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE----MVGEVL 178
             ++ I +   + P QLSGGQQQRVA+ARAL  +PK++LFDEP S LD      M  E+ 
Sbjct: 117 ARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIK 176

Query: 179 DVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
            + ++L   G+T V VTH+   A  +A R+   + G++V+ G P+E++  PK     SF+
Sbjct: 177 HLQQEL---GITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFI 233


>2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 361

 Score =  157 bits (398), Expect = 2e-41
 Identities = 94/235 (40%), Positives = 137/235 (58%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           I++ N+ K FG    L  I+L++  GE + ++GPSGSGKSTL+ TI  +     G++  D
Sbjct: 3   IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFD 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
               KD   L    R VG+VFQ + L+PHMTV +N+   P+ +R+ PR            
Sbjct: 63  E---KDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAF-PLELRKAPREEIDKKVREVAK 118

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL 184
            + I     +YP QLSGGQQQRVAIARAL  EP+++L DEP S LD  +  EV   ++ L
Sbjct: 119 MLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRL 178

Query: 185 AQG-GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
            +  G+T V VTH+   A  +ADR+  +  G+I++ G P+E++ +PK +    FL
Sbjct: 179 QKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL 233


>2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 362

 Score =  157 bits (398), Expect = 2e-41
 Identities = 94/235 (40%), Positives = 137/235 (58%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           I++ N+ K FG    L  I+L++  GE + ++GPSGSGKSTL+ TI  +     G++  D
Sbjct: 4   IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFD 63

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
               KD   L    R VG+VFQ + L+PHMTV +N+   P+ +R+ PR            
Sbjct: 64  E---KDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAF-PLELRKAPREEIDKKVREVAK 119

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL 184
            + I     +YP QLSGGQQQRVAIARAL  EP+++L DEP S LD  +  EV   ++ L
Sbjct: 120 MLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRL 179

Query: 185 AQG-GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
            +  G+T V VTH+   A  +ADR+  +  G+I++ G P+E++ +PK +    FL
Sbjct: 180 QKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL 234


>1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
          Length = 372

 Score =  142 bits (358), Expect = 1e-36
 Identities = 77/238 (32%), Positives = 135/238 (56%), Gaps = 5/238 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           +R+ ++ K FG +  ++ + LEV  GE ++++GPSG GK+T +R I  LE+   G++ + 
Sbjct: 4   VRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIG 63

Query: 65  GLNVKDDRA---LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXX 121
              V D      +    R++ MVFQ + L+PHMTV +N+   P+++R+ PR         
Sbjct: 64  DKLVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAF-PLKLRKVPRQEIDQRVRE 122

Query: 122 XXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVM 181
               +G+ +   + P +LSGGQ+QRVA+ RA+  +P++ L DEP S LD ++   +   +
Sbjct: 123 VAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAEL 182

Query: 182 RDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
           + L  Q G+T + VTH+   A  + DR+  M+ G + + G P+E++ +P       F+
Sbjct: 183 KKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFI 240


>1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 232

 Score =  141 bits (355), Expect = 2e-36
 Identities = 89/227 (39%), Positives = 138/227 (60%), Gaps = 12/227 (5%)

Query: 4   IIRIRNLHKWFGP----LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEG 59
           +I+++N+ K +      ++ LK ++L +  GE + I+GPSGSGKST++  I  L+   EG
Sbjct: 1   MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEG 60

Query: 60  EVVVDGL--NVKDDRALREVRRE-VGMVFQQFNLFPHMTVLENVTLAPM-RVRRWPRXXX 115
           EV +D +  N  DD  L ++RR+ +G VFQQFNL P +T LENV L  + + R       
Sbjct: 61  EVYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEE 120

Query: 116 XXXXXXXXXRVGILDQ--ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM 173
                    ++  L++  A   P QLSGGQQQRVAIARALA  P I+L D+PT ALD + 
Sbjct: 121 RRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKT 180

Query: 174 VGEVLDVMRDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEE 219
             +++ +++ L  + G T+VVVTH++  AR   +R++++  G++  E
Sbjct: 181 GEKIMQLLKKLNEEDGKTVVVVTHDINVAR-FGERIIYLKDGEVERE 226


>1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 230

 Score =  141 bits (355), Expect = 2e-36
 Identities = 89/227 (39%), Positives = 138/227 (60%), Gaps = 12/227 (5%)

Query: 4   IIRIRNLHKWFGP----LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEG 59
           +I+++N+ K +      ++ LK ++L +  GE + I+GPSGSGKST++  I  L+   EG
Sbjct: 1   MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEG 60

Query: 60  EVVVDGL--NVKDDRALREVRRE-VGMVFQQFNLFPHMTVLENVTLAPM-RVRRWPRXXX 115
           EV +D +  N  DD  L ++RR+ +G VFQQFNL P +T LENV L  + + R       
Sbjct: 61  EVYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEE 120

Query: 116 XXXXXXXXXRVGILDQ--ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM 173
                    ++  L++  A   P QLSGGQQQRVAIARALA  P I+L D+PT ALD + 
Sbjct: 121 RRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKT 180

Query: 174 VGEVLDVMRDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEE 219
             +++ +++ L  + G T+VVVTH++  AR   +R++++  G++  E
Sbjct: 181 GEKIMQLLKKLNEEDGKTVVVVTHDINVAR-FGERIIYLKDGEVERE 226


>2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
          Length = 223

 Score =  138 bits (347), Expect = 2e-35
 Identities = 88/219 (40%), Positives = 126/219 (57%), Gaps = 5/219 (2%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           I+R  N+ K      +LKGI L V  GE + IIG SGSGKSTL+  +  L+   EG+V +
Sbjct: 3   ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFL 62

Query: 64  DGLNVK--DDRALREVR-REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXX 120
           +G  V   +++ L  +R R++G VFQ   L P +T LENV + PM     P+        
Sbjct: 63  EGKEVDYTNEKELSLLRNRKLGFVFQFHYLIPELTALENV-IVPMLKMGKPKKEAKERGE 121

Query: 121 XXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV 180
                +G+ D+  + P +LSGG+QQRVAIARALA EP ++  DEPT  LD      V+D+
Sbjct: 122 YLLSELGLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDI 181

Query: 181 MRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEE 219
              + +GG ++V+VTHE   A E+  R + M  G++V E
Sbjct: 182 FLKINEGGTSIVMVTHERELA-ELTHRTLEMKDGKVVGE 219


>3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
          Length = 348

 Score =  136 bits (342), Expect = 7e-35
 Identities = 82/222 (36%), Positives = 127/222 (57%), Gaps = 12/222 (5%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L  + L+V  GE  VI+GP+G+GK+  +  I        G +++DG +V D   L   + 
Sbjct: 16  LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTD---LSPEKH 72

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQL 139
           ++  V+Q ++LFPHM V +N+    MR+++                  +LD   + P  L
Sbjct: 73  DIAFVYQNYSLFPHMNVKKNLEFG-MRMKKIKDPKRVLDTARDLKIEHLLD---RNPLTL 128

Query: 140 SGGQQQRVAIARALAMEPKIMLFDEPTSALDP---EMVGEVLDVMRDLAQGGMTMVVVTH 196
           SGG+QQRVA+ARAL   PKI+L DEP SALDP   E   E+L V+    +  +T++ +TH
Sbjct: 129 SGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLH--KKNKLTVLHITH 186

Query: 197 EMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
           +   AR +ADR+  +  G++++ G+PEEIF +P E R  SF+
Sbjct: 187 DQTEARIMADRIAVVMDGKLIQVGKPEEIFEKPVEGRVASFV 228


>1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 225

 Score =  135 bits (341), Expect = 1e-34
 Identities = 93/223 (41%), Positives = 133/223 (59%), Gaps = 12/223 (5%)

Query: 5   IRIRNLHKWFGP---LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEV 61
           I+++N+ K +     ++ LK ++L +  GE  V IGPSGSGKSTL   I  L+   EGEV
Sbjct: 1   IKLKNVTKTYKGEEIIYALKNVNLNIKEGE-FVSIGPSGSGKSTL-NIIGCLDKPTEGEV 58

Query: 62  VVDGL--NVKDDRALREVRRE-VGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXX 118
            +D +  N  DD  L ++RR+ +G VFQQFNL P +T LENV L  +   R         
Sbjct: 59  YIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEERRK 118

Query: 119 XXXXXXRVGILDQ-ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEV 177
                 +  + ++ A   P QLSGGQQQRVAIARALA  P I+L DEPT ALD +  GE 
Sbjct: 119 RALECLKAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSK-TGEK 177

Query: 178 LDVMRDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEE 219
           + +++ L  + G T+VVVTH++  AR   +R++++  G++  E
Sbjct: 178 IQLLKKLNEEDGKTVVVVTHDINVAR-FGERIIYLKDGEVERE 219


>1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
          Length = 367

 Score =  135 bits (340), Expect = 1e-34
 Identities = 79/235 (33%), Positives = 130/235 (55%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 1   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 60

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L+PH++V EN++   +++    +            
Sbjct: 61  EKRMND---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAE 116

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRD 183
            + +     + P  LSGGQ+QRVAI R L  EP + L DEP S LD  + V   +++ R 
Sbjct: 117 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 176

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 177 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 231


>3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score =  135 bits (340), Expect = 1e-34
 Identities = 79/235 (33%), Positives = 130/235 (55%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L+PH++V EN++   +++    +            
Sbjct: 63  EKRMND---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAE 118

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRD 183
            + +     + P  LSGGQ+QRVAI R L  EP + L DEP S LD  + V   +++ R 
Sbjct: 119 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 178

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 179 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 233


>2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score =  135 bits (340), Expect = 1e-34
 Identities = 79/235 (33%), Positives = 130/235 (55%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L+PH++V EN++   +++    +            
Sbjct: 63  EKRMND---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAE 118

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRD 183
            + +     + P  LSGGQ+QRVAI R L  EP + L DEP S LD  + V   +++ R 
Sbjct: 119 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 178

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 179 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 233


>2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 374

 Score =  135 bits (340), Expect = 1e-34
 Identities = 79/235 (33%), Positives = 130/235 (55%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L+PH++V EN++   +++    +            
Sbjct: 63  EKRMND---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAE 118

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRD 183
            + +     + P  LSGGQ+QRVAI R L  EP + L DEP S LD  + V   +++ R 
Sbjct: 119 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 178

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 179 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 233


>2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score =  134 bits (337), Expect = 3e-34
 Identities = 78/235 (33%), Positives = 130/235 (55%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L+PH++V EN++   +++    +            
Sbjct: 63  EKRMND---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAE 118

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRD 183
            + +     + P  LSGGQ+QRVAI R L  EP + L D+P S LD  + V   +++ R 
Sbjct: 119 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRL 178

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 179 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 233


>2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score =  134 bits (337), Expect = 3e-34
 Identities = 78/235 (33%), Positives = 130/235 (55%), Gaps = 5/235 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L+PH++V EN++   +++    +            
Sbjct: 63  EKRMND---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAE 118

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRD 183
            + +     + P  LSGGQ+QRVAI R L  EP + L D+P S LD  + V   +++ R 
Sbjct: 119 VLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRL 178

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 179 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 233


>1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 342

 Score =  120 bits (301), Expect = 4e-30
 Identities = 74/225 (32%), Positives = 119/225 (52%), Gaps = 5/225 (2%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G    ++G+  ++  GE + ++GPSGSGK+T++R I  LE   +G+V + G  V D   L
Sbjct: 13  GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTD---L 69

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARK 134
              +R VG+VFQ + LF HMTV +NV+   +R +R P+             + +   A +
Sbjct: 70  PPQKRNVGLVFQNYALFQHMTVYDNVSFG-LREKRVPKDEMDARVRELLRFMRLESYANR 128

Query: 135 YPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL-AQGGMTMVV 193
           +P +LSGG                   FDEP +A+D ++  E+   +R +  + G+T V 
Sbjct: 129 FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVF 188

Query: 194 VTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
           VTH+   A EVADRV+ +  G + + G PEE++ +P      SF+
Sbjct: 189 VTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFI 233


>1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 345

 Score =  120 bits (301), Expect = 4e-30
 Identities = 74/225 (32%), Positives = 119/225 (52%), Gaps = 5/225 (2%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G    ++G+  ++  GE + ++GPSGSGK+T++R I  LE   +G+V + G  V D   L
Sbjct: 16  GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTD---L 72

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARK 134
              +R VG+VFQ + LF HMTV +NV+   +R +R P+             + +   A +
Sbjct: 73  PPQKRNVGLVFQNYALFQHMTVYDNVSFG-LREKRVPKDEMDARVRELLRFMRLESYANR 131

Query: 135 YPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL-AQGGMTMVV 193
           +P +LSGG                   FDEP +A+D ++  E+   +R +  + G+T V 
Sbjct: 132 FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVF 191

Query: 194 VTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
           VTH+   A EVADRV+ +  G + + G PEE++ +P      SF+
Sbjct: 192 VTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFI 236


>2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 363

 Score =  117 bits (293), Expect = 4e-29
 Identities = 74/221 (33%), Positives = 117/221 (52%), Gaps = 9/221 (4%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ +    + D        
Sbjct: 10  VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP---AE 66

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
           R VGMV     L+PH++V EN++   +++    +             + +     + P  
Sbjct: 67  RGVGMVA----LYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA 121

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRDLAQGGMTMVVVTHE 197
           LSGGQ+QRVAI R L  EP + L DEP S LD  + V   +++ R   + G TM+ VTH+
Sbjct: 122 LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHD 181

Query: 198 MGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
              A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 182 QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 222


>1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
          Length = 241

 Score =  116 bits (290), Expect = 8e-29
 Identities = 77/210 (36%), Positives = 122/210 (58%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G SGSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 18  ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 73

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 74  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 132

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FDE TSALD E    ++  M  + + G T+
Sbjct: 133 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTV 191

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++ H +   +  ADR++ M+ G+IVE+G+
Sbjct: 192 IIIAHRLSTVKN-ADRIIVMEKGKIVEQGK 220


>2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  116 bits (290), Expect = 8e-29
 Identities = 77/210 (36%), Positives = 122/210 (58%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G SGSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 20  ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 75

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 76  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 134

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FDE TSALD E    ++  M  + + G T+
Sbjct: 135 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTV 193

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++ H +   +  ADR++ M+ G+IVE+G+
Sbjct: 194 IIIAHRLSTVKN-ADRIIVMEKGKIVEQGK 222


>2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score =  115 bits (287), Expect = 2e-28
 Identities = 76/210 (36%), Positives = 122/210 (58%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G SGSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 18  ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 73

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 74  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 132

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FD+ TSALD E    ++  M  + + G T+
Sbjct: 133 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTV 191

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++ H +   +  ADR++ M+ G+IVE+G+
Sbjct: 192 IIIAHRLSTVKN-ADRIIVMEKGKIVEQGK 220


>2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  115 bits (287), Expect = 2e-28
 Identities = 76/210 (36%), Positives = 122/210 (58%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G SGSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 20  ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 75

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 76  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 134

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FD+ TSALD E    ++  M  + + G T+
Sbjct: 135 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTV 193

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++ H +   +  ADR++ M+ G+IVE+G+
Sbjct: 194 IIIAHRLSTVKN-ADRIIVMEKGKIVEQGK 222


>3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  115 bits (287), Expect = 2e-28
 Identities = 76/210 (36%), Positives = 122/210 (58%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G +GSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 20  ILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 75

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 76  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 134

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FDE TSALD E    ++  M  + + G T+
Sbjct: 135 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTV 193

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++ H +   +  ADR++ M+ G+IVE+G+
Sbjct: 194 IIIAHRLSTVKN-ADRIIVMEKGKIVEQGK 222


>2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
          Length = 361

 Score =  114 bits (286), Expect = 2e-28
 Identities = 75/237 (31%), Positives = 132/237 (55%), Gaps = 12/237 (5%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           +++ N+ K FG +  +K + LE+  GE LV++GPSG GK+T +R I  LE+   G++ ++
Sbjct: 5   VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIE 63

Query: 65  GLNVKDDRA---LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXX 121
              V D      +    R+V  VFQ + L+PH TV +N+   P+++R+ P+         
Sbjct: 64  DNLVADPEKGVFVPPKERDVA-VFQSYALYPH-TVYDNIAF-PLKLRKVPK-QEIDKRVR 119

Query: 122 XXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVM 181
               +G+ +   + P +LSGGQ+QRVA+ RA+   PK+ L DEP S LD ++  +  ++ 
Sbjct: 120 EVAELGLTELLNRKPRELSGGQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELK 178

Query: 182 RDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
           +   Q G+T + VTH+        DR+  ++ G++ + G P+E++ +P       F+
Sbjct: 179 KLQRQLGVTTIYVTHDQ--VEATGDRIA-VNKGELQQVGTPDEVYYKPVNTFVAGFI 232


>3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score =  114 bits (285), Expect = 3e-28
 Identities = 80/221 (36%), Positives = 118/221 (53%), Gaps = 24/221 (10%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE 76
           + +LKG++L+V  G+ + ++G SG GKST ++ + RL D  +G V +DG +++    +R 
Sbjct: 371 VQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTIN-VRY 429

Query: 77  VRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXR-VGILDQARKY 135
           +R  +G+V Q+  LF   T+ EN+        R+ R            +     D   K 
Sbjct: 430 LREIIGVVSQEPVLFA-TTIAENI--------RYGREDVTMDEIEKAVKEANAYDFIMKL 480

Query: 136 P-----------AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL 184
           P           AQLSGGQ+QR+AIARAL   PKI+L DE TSALD E    V+    D 
Sbjct: 481 PHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEA-VVQAALDK 539

Query: 185 AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           A+ G T +V+ H +   R  AD +   DGG IVE+G  +E+
Sbjct: 540 AREGRTTIVIAHRLSTVRN-ADVIAGFDGGVIVEQGNHDEL 579



 Score =  103 bits (256), Expect = 7e-25
 Identities = 73/218 (33%), Positives = 115/218 (52%), Gaps = 14/218 (6%)

Query: 19   VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
            VL+G+ LEV  G+ L ++G SG GKST+++ + R  D   G V +DG  +K    ++ +R
Sbjct: 959  VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLN-VQWLR 1017

Query: 79   REVGMVFQQFNLFPHMTVLENVTLAP-MRVRRWPRXXXXXXXXXXXXRVGILDQARKYPA 137
             ++G+V Q+  LF   ++ EN+      RV  +               +  L    KY  
Sbjct: 1018 AQLGIVSQEPILFD-CSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPD--KYNT 1074

Query: 138  -------QLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMT 190
                   QLSGGQ+QR+AIARAL  +P I+L DE TSALD E    V + + D A+ G T
Sbjct: 1075 RVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEAL-DKAREGRT 1133

Query: 191  MVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
             +V+ H +   +  AD +V +  G++ E G  +++  +
Sbjct: 1134 CIVIAHRLSTIQN-ADLIVVIQNGKVKEHGTHQQLLAQ 1170


>3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score =  114 bits (285), Expect = 3e-28
 Identities = 80/221 (36%), Positives = 118/221 (53%), Gaps = 24/221 (10%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE 76
           + +LKG++L+V  G+ + ++G SG GKST ++ + RL D  +G V +DG +++    +R 
Sbjct: 371 VQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTIN-VRY 429

Query: 77  VRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXR-VGILDQARKY 135
           +R  +G+V Q+  LF   T+ EN+        R+ R            +     D   K 
Sbjct: 430 LREIIGVVSQEPVLFA-TTIAENI--------RYGREDVTMDEIEKAVKEANAYDFIMKL 480

Query: 136 P-----------AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL 184
           P           AQLSGGQ+QR+AIARAL   PKI+L DE TSALD E    V+    D 
Sbjct: 481 PHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEA-VVQAALDK 539

Query: 185 AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           A+ G T +V+ H +   R  AD +   DGG IVE+G  +E+
Sbjct: 540 AREGRTTIVIAHRLSTVRN-ADVIAGFDGGVIVEQGNHDEL 579



 Score =  103 bits (256), Expect = 7e-25
 Identities = 73/218 (33%), Positives = 115/218 (52%), Gaps = 14/218 (6%)

Query: 19   VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
            VL+G+ LEV  G+ L ++G SG GKST+++ + R  D   G V +DG  +K    ++ +R
Sbjct: 959  VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLN-VQWLR 1017

Query: 79   REVGMVFQQFNLFPHMTVLENVTLAP-MRVRRWPRXXXXXXXXXXXXRVGILDQARKYPA 137
             ++G+V Q+  LF   ++ EN+      RV  +               +  L    KY  
Sbjct: 1018 AQLGIVSQEPILFD-CSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPD--KYNT 1074

Query: 138  -------QLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMT 190
                   QLSGGQ+QR+AIARAL  +P I+L DE TSALD E    V + + D A+ G T
Sbjct: 1075 RVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEAL-DKAREGRT 1133

Query: 191  MVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
             +V+ H +   +  AD +V +  G++ E G  +++  +
Sbjct: 1134 CIVIAHRLSTIQN-ADLIVVIQNGKVKEHGTHQQLLAQ 1170


>1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 353

 Score =  114 bits (284), Expect = 4e-28
 Identities = 73/242 (30%), Positives = 125/242 (51%), Gaps = 6/242 (2%)

Query: 5   IRIRNLHKWF--GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVV 62
           I ++N+ K F  G +  L  +++ +  GE+  I+GPSG+GK+T +R I  L+    GE+ 
Sbjct: 4   IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63

Query: 63  VDGLNVKDDRAL--REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXX 120
            D   V  +  L      R++GMVFQ + L+P++T  EN+   P+   +  +        
Sbjct: 64  FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVE 122

Query: 121 XXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV 180
                + I      +P +LSGGQQQRVA+ARAL  +P ++L DEP S LD  M      +
Sbjct: 123 EVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL 182

Query: 181 MRDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQ 239
           ++++ ++ G+T++VV+H+      +ADR              PE+++  P   +  S + 
Sbjct: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRXXXXXXXXXXXXXXPEDLYDNPVSIQVASLIG 242

Query: 240 RV 241
            +
Sbjct: 243 EI 244


>1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score =  114 bits (284), Expect = 4e-28
 Identities = 73/242 (30%), Positives = 125/242 (51%), Gaps = 6/242 (2%)

Query: 5   IRIRNLHKWF--GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVV 62
           I ++N+ K F  G +  L  +++ +  GE+  I+GPSG+GK+T +R I  L+    GE+ 
Sbjct: 4   IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63

Query: 63  VDGLNVKDDRAL--REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXX 120
            D   V  +  L      R++GMVFQ + L+P++T  EN+   P+   +  +        
Sbjct: 64  FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVE 122

Query: 121 XXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV 180
                + I      +P +LSGGQQQRVA+ARAL  +P ++L DEP S LD  M      +
Sbjct: 123 EVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL 182

Query: 181 MRDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQ 239
           ++++ ++ G+T++VV+H+      +ADR              PE+++  P   +  S + 
Sbjct: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRXXXXXXXXXXXXXXPEDLYDNPVSIQVASLIG 242

Query: 240 RV 241
            +
Sbjct: 243 EI 244


>2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 344

 Score =  113 bits (282), Expect = 7e-28
 Identities = 72/221 (32%), Positives = 112/221 (50%), Gaps = 28/221 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           V K I+L++  GE +V +GPSG GKSTL+R I  L                         
Sbjct: 10  VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG------------------------ 45

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
             VGMVFQ + L+PH++V EN++   +++    +             + +     + P  
Sbjct: 46  --VGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA 102

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEM-VGEVLDVMRDLAQGGMTMVVVTHE 197
           LSGGQ+QRVAI R L  EP + L DEP S LD  + V   +++ R   + G TM+ VTH+
Sbjct: 103 LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHD 162

Query: 198 MGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
              A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 163 QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 203


>1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
           ATP-BINDING PROTEIN
          Length = 353

 Score =  112 bits (281), Expect = 9e-28
 Identities = 73/235 (31%), Positives = 117/235 (49%), Gaps = 13/235 (5%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           +++ NL K FG    +  ++L +  GE LV++GPSG GK+T +R I  LE+  EG +   
Sbjct: 7   VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIY-- 64

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
               +D   L    R + MVFQ      HMTV EN+      ++++P+            
Sbjct: 65  -FGDRDVTYLPPKDRNISMVFQ------HMTVYENIAFP---LKKFPKDEIDKRVRWAAE 114

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL 184
            + I +   +YPAQLSGG             EP ++L DEP S LD ++   +   ++ L
Sbjct: 115 LLQIEELLNRYPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKL 174

Query: 185 AQG-GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
            Q   +T + VTH+   A  + DR+  M+ GQ+++ G P E++ RP      +F+
Sbjct: 175 QQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFI 229


>1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score =  112 bits (280), Expect = 1e-27
 Identities = 76/210 (36%), Positives = 121/210 (57%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G SGSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 18  ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 73

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 74  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 132

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FDE TSALD E    ++  M  + + G T+
Sbjct: 133 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTV 191

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++   +   +  ADR++ M+ G+IVE+G+
Sbjct: 192 IIIAARLSTVKN-ADRIIVMEKGKIVEQGK 220


>2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  112 bits (280), Expect = 1e-27
 Identities = 76/210 (36%), Positives = 121/210 (57%), Gaps = 14/210 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALRE-- 76
           +L  I+L +  GE + I+G SGSGKSTL + I R    + G+V++DG     D AL +  
Sbjct: 20  ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----HDLALADPN 75

Query: 77  -VRREVGMVFQQFNLFPHMTVLENVTLAP--MRVRR--WPRXXXXXXXXXXXXRVGILDQ 131
            +RR+VG+V Q  N+  + ++++N++LA   M V +  +              R G    
Sbjct: 76  WLRRQVGVVLQD-NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI 134

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +  A LSGGQ+QR+AIARAL   PKI++FDE TSALD E    ++  M  + + G T+
Sbjct: 135 VGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTV 193

Query: 192 VVVTHEMGFAREVADRVVFMDGGQIVEEGR 221
           +++   +   +  ADR++ M+ G+IVE+G+
Sbjct: 194 IIIAARLSTVKN-ADRIIVMEKGKIVEQGK 222


>2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
          Length = 240

 Score =  108 bits (271), Expect = 1e-26
 Identities = 75/200 (37%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 34  VIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRREVGMVFQQFNLFPH 93
           V++GP+G+GKS  +  I  +     GEV ++G ++     L   RR +G V Q + LFPH
Sbjct: 28  VLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITP---LPPERRGIGFVPQDYALFPH 84

Query: 94  MTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLSGGQQQRVAIARAL 153
           ++V  N+      +                 ++GI     + PA+LSGG++QRVA+ARAL
Sbjct: 85  LSVYRNIAYG---LXXXXXXXXXXXXXXMAEKLGIAHLLDRKPARLSGGERQRVALARAL 141

Query: 154 AMEPKIMLFDEPTSALDPEMVGEVLDVMRDL-AQGGMTMVVVTHEMGFAREVADRVVFMD 212
            ++P+++L DEP SA+D +  G +++ +R +  +  + ++ VTH++  A  +AD V  M 
Sbjct: 142 VIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVML 201

Query: 213 GGQIVEEGRPEEIFTRPKEE 232
            G+IVE+G+ +E+F+    E
Sbjct: 202 NGRIVEKGKLKELFSAKNGE 221


>3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 350

 Score =  108 bits (271), Expect = 1e-26
 Identities = 72/229 (31%), Positives = 113/229 (49%), Gaps = 3/229 (1%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           + I +L K F    VL  I L + PGE L IIG SG GK+TL+R +   E    GE+ + 
Sbjct: 4   LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLS 63

Query: 65  GLNVKDDRALREVR-REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXX 123
           G  +        VR R +G + Q+  LFPH+TV  N+    +   +              
Sbjct: 64  GKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAML 122

Query: 124 XRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-DVMR 182
              GI + A +YP +LSGG             +P+++L DEP SALD ++  ++  D++ 
Sbjct: 123 ELTGISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIA 182

Query: 183 DLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKE 231
            L   G + V V+H+   A + ADR+  M  G+I++   P E++ +P +
Sbjct: 183 ALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPAD 231


>3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 343

 Score =  108 bits (271), Expect = 1e-26
 Identities = 72/229 (31%), Positives = 113/229 (49%), Gaps = 3/229 (1%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           + I +L K F    VL  I L + PGE L IIG SG GK+TL+R +   E    GE+ + 
Sbjct: 4   LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLS 63

Query: 65  GLNVKDDRALREVR-REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXX 123
           G  +        VR R +G + Q+  LFPH+TV  N+    +   +              
Sbjct: 64  GKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAML 122

Query: 124 XRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-DVMR 182
              GI + A +YP +LSGG             +P+++L DEP SALD ++  ++  D++ 
Sbjct: 123 ELTGISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIA 182

Query: 183 DLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKE 231
            L   G + V V+H+   A + ADR+  M  G+I++   P E++ +P +
Sbjct: 183 ALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPAD 231


>1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 253

 Score =  105 bits (263), Expect = 1e-25
 Identities = 67/233 (28%), Positives = 107/233 (45%), Gaps = 12/233 (5%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           I+R  N+ K+FG    L G+ + V  G+  +IIGP+GSGKSTLI  I       EG V  
Sbjct: 4   ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 63

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWP------RXXXXX 117
           +  ++ +          +   FQ       MTVLEN+ +  +     P      +     
Sbjct: 64  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPK 123

Query: 118 XXXXXXXRVGILDQAR------KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDP 171
                     IL+  +      +   +LSGGQ + V I RAL   PK+++ DEP + + P
Sbjct: 124 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 172 EMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEE 224
            +  ++ + + +L   G+T +++ H +       D +  M  GQI+ EGR EE
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEE 236


>1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 254

 Score =  104 bits (260), Expect = 2e-25
 Identities = 69/233 (29%), Positives = 109/233 (46%), Gaps = 12/233 (5%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           I+R  N+ K+FG    L G+ + V  G+  +IIGP+GSGKSTLI  I       EG V  
Sbjct: 4   ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 63

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTL-------APMR---VRRW-PR 112
           +  ++ +          +   FQ       MTVLEN+ +       +P+     ++W P+
Sbjct: 64  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPK 123

Query: 113 XXXXXXXXXXXXRVGILDQARKYPA-QLSGGQQQRVAIARALAMEPKIMLFDEPTSALDP 171
                           L       A +LSGGQ + V I RAL   PK+++ DEP + + P
Sbjct: 124 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 172 EMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEE 224
            +  ++ + + +L   G+T +++ H +       D +  M  GQI+ EGR EE
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEE 236


>1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
          Length = 253

 Score =  103 bits (258), Expect = 4e-25
 Identities = 66/233 (28%), Positives = 107/233 (45%), Gaps = 12/233 (5%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           I+R  N+ K+FG    L G+ + V  G+  +IIGP+GSGKSTLI  I       EG V  
Sbjct: 3   ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 62

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWP------RXXXXX 117
           +  ++ +          +   FQ       MTVLEN+ +  +     P      +     
Sbjct: 63  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPK 122

Query: 118 XXXXXXXRVGILDQAR------KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDP 171
                     IL+  +      +   +LSGGQ + V I RAL   PK+++ D+P + + P
Sbjct: 123 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAP 182

Query: 172 EMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEE 224
            +  ++ + + +L   G+T +++ H +       D +  M  GQI+ EGR EE
Sbjct: 183 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEE 235


>1ji0A [c.37.1] ABC TRANSPORTER
          Length = 231

 Score =  103 bits (256), Expect = 7e-25
 Identities = 67/222 (30%), Positives = 124/222 (55%), Gaps = 8/222 (3%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           ++ +++LH ++G +H +KGI L+V  G+ + +IG +G+GK+T +  I  L   Q+G+++ 
Sbjct: 5   VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIF 64

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXX 123
           +G ++ +  A   + R + +V +   +FP +TV EN+     + +   +           
Sbjct: 65  NGQDITNKPA-HVINRGIALVPEGRRIFPELTVYENLGAYNRKDKEGIKRDLEWIFSLFP 123

Query: 124 XRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRD 183
               + ++ ++    LSGG+QQ +AI RAL+  PK  L DEP+  L P +V EV +V++ 
Sbjct: 124 R---LKERLKQLGGTLSGGEQQ-LAIGRALS-RPK--LLDEPSLGLAPILVSEVFEVIQK 176

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           + Q G T+++V      A +VA     ++ GQIV EG+  E+
Sbjct: 177 INQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASEL 218


>2hydA [x.x.x] ABC TRANSPORTER HOMOLOG
          Length = 578

 Score =  101 bits (251), Expect = 3e-24
 Identities = 73/218 (33%), Positives = 111/218 (50%), Gaps = 16/218 (7%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           +LK I+L +  GE +  +G SG GKSTLI  I R  D   G++++DG N+K D     +R
Sbjct: 356 ILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIK-DFLTGSLR 414

Query: 79  REVGMVFQQFNLFPHMTVLENV-----TLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR 133
            ++G+V QQ N+    TV EN+     T     V    +            + G   +  
Sbjct: 415 NQIGLV-QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQ-GYDTEVG 472

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE---MVGEVLDVMRDLAQGGMT 190
           +   +LSGGQ+QR++IAR     P I++ DE TSALD E   ++ E LDV+        T
Sbjct: 473 ERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVL----SKDRT 528

Query: 191 MVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
            ++V H +      AD++V ++ G IVE G   E+  +
Sbjct: 529 TLIVAHRLSTITH-ADKIVVIENGHIVETGTHRELIAK 565


>3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
          Length = 251

 Score = 97.4 bits (241), Expect = 4e-23
 Identities = 66/227 (29%), Positives = 112/227 (49%), Gaps = 5/227 (2%)

Query: 4   IIRIRNL-HKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVV 62
           I+++  L + +    H LKGI++ +  GE   I+G +G GKSTL +  N +     G ++
Sbjct: 4   ILKVEELNYNYSDGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRIL 63

Query: 63  VDGLNVKDDR-ALREVRREVGMVFQQ-FNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXX 120
            D   +   R  + ++R  +G+VFQ   N     +V ++V+   + ++  P         
Sbjct: 64  FDNKPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQDVSFGAVNMKL-PEDEIRKRVD 122

Query: 121 XXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV 180
               R GI     K    LS GQ++RVAIA  L MEPK+++ DEPT+ LDP  V E++ +
Sbjct: 123 NALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKL 182

Query: 181 MRDLAQG-GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIF 226
           + ++ +  G                 D V  M  G+++ +G P+E+F
Sbjct: 183 LVEMQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEVF 229


>2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 330

 Score = 95.5 bits (236), Expect = 1e-22
 Identities = 66/235 (28%), Positives = 112/235 (47%), Gaps = 47/235 (20%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
           ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3   VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65  GLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXX 124
              + D        R VGMVFQ + L                                  
Sbjct: 63  EKRMNDTPP---AERGVGMVFQSYAL---------------------------------- 85

Query: 125 RVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEV-LDVMRD 183
              +++Q     A++       +AI R L  EP + L DEP S LD  +  ++ +++ R 
Sbjct: 86  --EVINQRVNQVAEV-------LAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL 136

Query: 184 LAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFL 238
             + G TM+ VTH+   A  +AD++V +D G++ + G+P E++  P +     F+
Sbjct: 137 HKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI 191


>1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
          Length = 520

 Score = 94.4 bits (233), Expect = 3e-22
 Identities = 65/208 (31%), Positives = 106/208 (50%), Gaps = 11/208 (5%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L  +   +  G+ + ++G SGSGKST+     R  D   G + +DG +V+D + L  +RR
Sbjct: 315 LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYK-LTNLRR 373

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPM------RVRRWPRXXXXXXXXXXXXRVGILDQAR 133
              +V Q  +LF + T+  N+  A        ++ +  R            + G+     
Sbjct: 374 HFALVSQNVHLF-NDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQ-GLDTVIG 431

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+QRVAIARAL  +  +++ DE TSALD E    +   + +L Q   T++V
Sbjct: 432 ENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL-QKNKTVLV 490

Query: 194 VTHEMGFAREVADRVVFMDGGQIVEEGR 221
           + H +    E AD ++ +D G+I+E GR
Sbjct: 491 IAHRLS-TIEQADEILVVDEGEIIERGR 517


>1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 88.6 bits (218), Expect = 2e-20
 Identities = 62/242 (25%), Positives = 113/242 (46%), Gaps = 6/242 (2%)

Query: 5   IRIRNLHKWF--GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVV 62
           I ++N+ K F  G +  L  +++ +  GE+  I+GPSG+GK+T +R I  L+    GE+ 
Sbjct: 4   IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63

Query: 63  VDGLNVKDDRAL--REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXX 120
            D   V  +  L      R++GMVFQ + L+P++T  EN+   P+   +  +        
Sbjct: 64  FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVE 122

Query: 121 XXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV 180
                + I      +P +LSG              +P ++L DEP S LD  M      +
Sbjct: 123 EVAKILDIHHVLNHFPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARAL 182

Query: 181 MRDL-AQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQ 239
           ++++ ++ G+T++VV+H+      +ADR              PE+++  P   +  S + 
Sbjct: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRXXXXXXXXXXXXXXPEDLYDNPVSIQVASLIG 242

Query: 240 RV 241
            +
Sbjct: 243 EI 244


>1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 241

 Score = 88.6 bits (218), Expect = 2e-20
 Identities = 65/218 (29%), Positives = 103/218 (47%), Gaps = 21/218 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           +L+ I  E  P   +   GPSG GKST+   + R      GE+ +DG  + D+ +L   R
Sbjct: 17  ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI-DNISLENWR 75

Query: 79  REVGMVFQQFNLFPHMTVLENVT-----------LAPMRVRRWPRXXXXXXXXXXXXRVG 127
            ++G V Q   +    T+ EN+T           L  +    + R             VG
Sbjct: 76  SQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVG 134

Query: 128 ILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG 187
                 +   ++SGGQ+QR+AIARA    PKI++ DE T++LD E    V   +  L + 
Sbjct: 135 ------ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK- 187

Query: 188 GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           G T +V+ H +    + AD++ F++ GQI   G+  E+
Sbjct: 188 GRTTLVIAHRLSTIVD-ADKIYFIEKGQITGSGKHNEL 224


>1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 242

 Score = 88.6 bits (218), Expect = 2e-20
 Identities = 65/218 (29%), Positives = 103/218 (47%), Gaps = 21/218 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           +L+ I  E  P   +   GPSG GKST+   + R      GE+ +DG  + D+ +L   R
Sbjct: 17  ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI-DNISLENWR 75

Query: 79  REVGMVFQQFNLFPHMTVLENVT-----------LAPMRVRRWPRXXXXXXXXXXXXRVG 127
            ++G V Q   +    T+ EN+T           L  +    + R             VG
Sbjct: 76  SQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVG 134

Query: 128 ILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG 187
                 +   ++SGGQ+QR+AIARA    PKI++ DE T++LD E    V   +  L + 
Sbjct: 135 ------ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK- 187

Query: 188 GMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           G T +V+ H +    + AD++ F++ GQI   G+  E+
Sbjct: 188 GRTTLVIAHRLSTIVD-ADKIYFIEKGQITGSGKHNEL 224


>2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 263

 Score = 85.9 bits (211), Expect = 1e-19
 Identities = 64/212 (30%), Positives = 107/212 (50%), Gaps = 9/212 (4%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L+ + L +  GE L++ G +GSGKSTL++ +  L +   G+V+ DG   K      E+RR
Sbjct: 23  LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKG----YEIRR 78

Query: 80  EVGMVFQQ-FNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGI-LDQAR-KYP 136
            +G+ FQ   + F    V + V  A      +P              VG+  D  + + P
Sbjct: 79  NIGIAFQYPEDQFFAERVFDEVAFAVKNF--YPDRDPVPLVKKAMEFVGLDFDSFKDRVP 136

Query: 137 AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
             LSGG+++RVAIA  +  EP I++ DEP   LD E   ++L ++      G T+++++H
Sbjct: 137 FFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISH 196

Query: 197 EMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
           ++       DRVV ++ G+ V +G   E   +
Sbjct: 197 DIETVINHVDRVVVLEKGKKVFDGTRMEFLEK 228


>2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 266

 Score = 85.9 bits (211), Expect = 1e-19
 Identities = 64/212 (30%), Positives = 107/212 (50%), Gaps = 9/212 (4%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L+ + L +  GE L++ G +GSGKSTL++ +  L +   G+V+ DG   K      E+RR
Sbjct: 23  LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKG----YEIRR 78

Query: 80  EVGMVFQQ-FNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGI-LDQAR-KYP 136
            +G+ FQ   + F    V + V  A      +P              VG+  D  + + P
Sbjct: 79  NIGIAFQYPEDQFFAERVFDEVAFAVKNF--YPDRDPVPLVKKAMEFVGLDFDSFKDRVP 136

Query: 137 AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
             LSGG+++RVAIA  +  EP I++ DEP   LD E   ++L ++      G T+++++H
Sbjct: 137 FFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISH 196

Query: 197 EMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
           ++       DRVV ++ G+ V +G   E   +
Sbjct: 197 DIETVINHVDRVVVLEKGKKVFDGTRMEFLEK 228


>1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 83.2 bits (204), Expect = 7e-19
 Identities = 60/236 (25%), Positives = 107/236 (45%), Gaps = 3/236 (1%)

Query: 7   IRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGL 66
           +++L K  G   +LK                P+G+GK+T +R I+ L     G V V G 
Sbjct: 5   VKDLRKRIGKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGK 64

Query: 67  NVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV 126
           NV ++    EVR+ +  + ++   + +M  +E +                          
Sbjct: 65  NVVEEP--HEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEI-A 121

Query: 127 GILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ 186
           G+ ++ +   +  S G  +++ IARAL + P++ + DEPTS LD     EV  +++  +Q
Sbjct: 122 GLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQ 181

Query: 187 GGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQRVL 242
            G+T++V +H M     + DR+  +  G IVE G  EE+  R K +      + V+
Sbjct: 182 EGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIEEVFEEVV 237


>1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1
          Length = 251

 Score = 81.3 bits (199), Expect = 3e-18
 Identities = 59/216 (27%), Positives = 109/216 (50%), Gaps = 9/216 (4%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VL+G+   + PGE   ++GP+GSGKST+   +  L     G++++DG  +      R + 
Sbjct: 29  VLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEH-RYLH 87

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR----- 133
           R+V  V Q+  +F   ++ EN+     +                   +  L Q       
Sbjct: 88  RQVAAVGQEPQVFGR-SLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVD 146

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMV 192
           +  +QLSGGQ+Q VA+ARAL  +P +++ D+ TSALD     +V  ++ +  +    +++
Sbjct: 147 EAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVL 206

Query: 193 VVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
           ++T  +    E AD ++F++GG I E G  +++  +
Sbjct: 207 LITQHLSLV-EQADHILFLEGGAIREGGTHQQLMEK 241


>2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 252

 Score = 79.3 bits (194), Expect = 1e-17
 Identities = 65/222 (29%), Positives = 109/222 (49%), Gaps = 17/222 (7%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLN-VKDDRALR 75
           + VL+G+   + PG+   ++GP+GSGKST+   +  L     G+V++DG   V+ D    
Sbjct: 27  VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH--H 84

Query: 76  EVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV-----GILD 130
            +  +V  V Q+  LF   +  EN+     R                   +     G   
Sbjct: 85  YLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDT 143

Query: 131 QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ---- 186
           +  +   QLSGGQ+Q VA+ARAL  +P++++ D+ TSALD    G  L V R L +    
Sbjct: 144 EVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALD---AGNQLRVQRLLYESPEW 200

Query: 187 GGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
              T++++TH++  A E A  ++F+  G + E+G   ++  R
Sbjct: 201 ASRTVLLITHQLSLA-ERAHHILFLKEGSVCEQGTHLQLMER 241


>2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 255

 Score = 79.3 bits (194), Expect = 1e-17
 Identities = 65/222 (29%), Positives = 109/222 (49%), Gaps = 17/222 (7%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLN-VKDDRALR 75
           + VL+G+   + PG+   ++GP+GSGKST+   +  L     G+V++DG   V+ D    
Sbjct: 31  VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH--H 88

Query: 76  EVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV-----GILD 130
            +  +V  V Q+  LF   +  EN+     R                   +     G   
Sbjct: 89  YLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDT 147

Query: 131 QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ---- 186
           +  +   QLSGGQ+Q VA+ARAL  +P++++ D+ TSALD    G  L V R L +    
Sbjct: 148 EVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALD---AGNQLRVQRLLYESPEW 204

Query: 187 GGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
              T++++TH++  A E A  ++F+  G + E+G   ++  R
Sbjct: 205 ASRTVLLITHQLSLA-ERAHHILFLKEGSVCEQGTHLQLMER 245


>2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 248

 Score = 79.0 bits (193), Expect = 1e-17
 Identities = 64/218 (29%), Positives = 102/218 (46%), Gaps = 16/218 (7%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG--LNVKDDRAL 74
           + VL+G+   + PG+   ++GP+GSGKST+   +  L     G+V++DG  L   D   L
Sbjct: 29  VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYL 88

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARK 134
                 VG +     LF   +  EN+     R                   +    Q   
Sbjct: 89  HTQVAAVGPL-----LFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYD 142

Query: 135 YPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ----GGMT 190
              QLSGGQ+Q VA+ARAL  +P++++ D  TSALD    G  L V R L +       T
Sbjct: 143 TEVQLSGGQRQAVALARALIRKPRLLILDNATSALD---AGNQLRVQRLLYESPEWASRT 199

Query: 191 MVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
           ++++T ++  A E A  ++F+  G + E+G   ++  R
Sbjct: 200 VLLITQQLSLA-ERAHHILFLKEGSVCEQGTHLQLMER 236


>2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 250

 Score = 78.2 bits (191), Expect = 2e-17
 Identities = 66/225 (29%), Positives = 109/225 (48%), Gaps = 25/225 (11%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG--LNVKDDRAL 74
           + VL+G+   + PG+   ++GP+GSGKST+   +  L     G+V++DG  L   D   L
Sbjct: 28  VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYL 87

Query: 75  REVRREVGMVF--QQF--NLFPHMT---VLENVTLAPMRVRRWPRXXXXXXXXXXXXRVG 127
                 VG +   + F  N+   +T    +E +T   M                     G
Sbjct: 88  HTQVAAVGQLLFGRSFRENIAYGLTRTPTMEEITAVAME--------SGAHDFISGFPQG 139

Query: 128 ILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ- 186
              +  +   QLSGGQ+Q VA+ARAL  +P++++ D+ TSALD    G  L V R L + 
Sbjct: 140 YDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALD---AGNQLRVQRLLYES 196

Query: 187 ---GGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
                 T++++TH++  A E A  ++F+  G + E+G   ++  R
Sbjct: 197 PEWASRTVLLITHQLSLA-ERAHHILFLKEGSVCEQGTHLQLMER 240


>2ghiA [x.x.x] TRANSPORT PROTEIN
          Length = 255

 Score = 77.8 bits (190), Expect = 3e-17
 Identities = 59/217 (27%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           LK I+  +  G    ++G +GSGKST+ + + R  D  EG++ + G NV        +R 
Sbjct: 35  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYNR-NSIRS 92

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ- 138
            +G+V Q   LF + T+  N+    +                      + D     P + 
Sbjct: 93  IIGIVPQDTILF-NETIKYNILYGKLDAT-------DEEVIKATKSAQLYDFIEALPKKW 144

Query: 139 ----------LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGG 188
                     LSGG++QR+AIAR L  +PKI++FDE TS+LD +        + DL +  
Sbjct: 145 DTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-N 203

Query: 189 MTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
            T++++ H +      A+ ++ ++ G+IVE+G  +++
Sbjct: 204 RTLIIIAHRLSTISS-AESIILLNKGKIVEKGTHKDL 239


>2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 251

 Score = 75.5 bits (184), Expect = 2e-16
 Identities = 64/222 (28%), Positives = 107/222 (48%), Gaps = 17/222 (7%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLN-VKDDRALR 75
           + VL+G+   + PG+   ++GP+GSGKST+   +  L     G+V++DG   V+ D    
Sbjct: 27  VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH--H 84

Query: 76  EVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV-----GILD 130
            +  +V  V Q+  LF   +  EN+     R                   +     G   
Sbjct: 85  YLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDT 143

Query: 131 QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ---- 186
           +  +   QLSGGQ+Q VA+ARAL  +P++++ D  TSALD    G  L V R L +    
Sbjct: 144 EVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALD---AGNQLRVQRLLYESPEW 200

Query: 187 GGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
              T++++T ++  A E A  ++F+  G + E+G   ++  R
Sbjct: 201 ASRTVLLITQQLSLA-ERAHHILFLKEGSVCEQGTHLQLMER 241


>2ghiC [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score = 73.9 bits (180), Expect = 4e-16
 Identities = 59/210 (28%), Positives = 106/210 (50%), Gaps = 14/210 (6%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNV-KDDRALREVR 78
           LK I+  +  G    ++G +GSGKST+ + + R  D  EG++ + G NV K +R    +R
Sbjct: 35  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYNR--NSIR 91

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
             +G+V Q   LF + T+  N+    +                      I    +K+   
Sbjct: 92  SIIGIVPQDTILF-NETIKYNILYGKLDATE----EVIKATKSAQLYDFIEALPKKWDTI 146

Query: 139 LSG---GQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
           + G   G++QR+AIAR L  +PKI++FDE TS+LD +        + DL +   T++++ 
Sbjct: 147 VGGMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-NRTLIIIA 205

Query: 196 HEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           H +      A+ ++ ++ G+IVE+G  +++
Sbjct: 206 HRLSTISS-AESIILLNKGKIVEKGTHKDL 234


>2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 248

 Score = 72.0 bits (175), Expect = 2e-15
 Identities = 58/216 (26%), Positives = 104/216 (48%), Gaps = 21/216 (9%)

Query: 1   MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGE 60
           M   + + NL  ++      + ++ ++  G+ L ++G +G GKSTL+  +  +    +G+
Sbjct: 1   MNKALSVENLGFYY---QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGK 57

Query: 61  VVVDGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAP---MRVRRWPRXXXXX 117
           +              EV + +G V Q F+     +VL+ V +     +     P+     
Sbjct: 58  I--------------EVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQ 103

Query: 118 XXXXXXXRVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEV 177
                   + +   A++    LSGGQ+Q + IARA+A E K++L DEPTSALD      V
Sbjct: 104 VAMQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIV 163

Query: 178 LDVMRDLAQG-GMTMVVVTHEMGFAREVADRVVFMD 212
           L ++ DLAQ   MT+V  TH+      +A++ + ++
Sbjct: 164 LSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLLN 199


>2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 251

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 55/194 (28%), Positives = 96/194 (49%), Gaps = 18/194 (9%)

Query: 23  IHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRREVG 82
           ++ ++  G+ L ++G +G GKSTL+  +  +    +G++              EV + +G
Sbjct: 23  LNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI--------------EVYQSIG 68

Query: 83  MVFQQFNLFPHMTVLENVTLAP---MRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQL 139
            V Q F+     +VL+ V +     +     P+             + +   A++    L
Sbjct: 69  FVPQFFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSL 128

Query: 140 SGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMVVVTHEM 198
           SGGQ+Q + IARA+A E K++L DEPTSALD      VL ++ DLAQ   MT+V  TH+ 
Sbjct: 129 SGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQP 188

Query: 199 GFAREVADRVVFMD 212
                +A++ + ++
Sbjct: 189 NQVVAIANKTLLLN 202


>2d2fA [x.x.x] SUFC PROTEIN
          Length = 246

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 58/227 (25%), Positives = 106/227 (46%), Gaps = 9/227 (3%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDF--QEGEVV 62
           + IR+L        +LKG++L V  GE   ++GP+G+GKSTL + +    ++  + GE++
Sbjct: 3   LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL 62

Query: 63  VDGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXX 122
           +DG N+ +       R+ + + FQ     P +T+   + LA ++ +              
Sbjct: 63  LDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLA-LQAKLGREVGVAEFWTKV 121

Query: 123 XXRVGILDQARKYPAQ-----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEV 177
              + +LD    Y ++      SGG+++R  I + L +EP   + DE  S LD + +  V
Sbjct: 122 KKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVV 181

Query: 178 LDVMRDLAQGGMTMVVVTHEMGFAREV-ADRVVFMDGGQIVEEGRPE 223
              +  +       +V+TH       +  D+V  M  G++V  G PE
Sbjct: 182 ARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPE 228


>2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 254

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 62/222 (27%), Positives = 106/222 (47%), Gaps = 17/222 (7%)

Query: 17  LHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLN-VKDDRALR 75
           + VL+G+   + PG+   ++GP+GSGKST+   +  L     G+V++DG   V+ D    
Sbjct: 29  VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH--H 86

Query: 76  EVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV-----GILD 130
            +  +V  V Q+  LF   +  EN+     R                   +     G   
Sbjct: 87  YLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDT 145

Query: 131 QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ---- 186
           +  +   QL+ GQ+Q VA+ARAL  +P++++ D  TSALD    G  L V R L +    
Sbjct: 146 EVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALD---AGNQLRVQRLLYESPEW 202

Query: 187 GGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
              T++++T ++  A E A  ++F+  G + E+G   ++  R
Sbjct: 203 ASRTVLLITQQLSLA-ERAHHILFLKEGSVCEQGTHLQLMER 243


>2ghiB [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score = 70.9 bits (172), Expect = 4e-15
 Identities = 58/216 (26%), Positives = 102/216 (47%), Gaps = 26/216 (12%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           LK I+  +  G    ++G +GSGKST+ + + R  D  EG++ + G NV        +R 
Sbjct: 35  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYNR-NSIRS 92

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ- 138
            +G+V Q   LF + T+  N+    +                      + D     P + 
Sbjct: 93  IIGIVPQDTILF-NETIKYNILYGKLDAT-------DEEVIKATKSAQLYDFIEALPKKW 144

Query: 139 ---------LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGM 189
                    LSGG++QR+AIAR L  +PKI++FDE TS    E + +    + DL +   
Sbjct: 145 DTIVGNKMKLSGGERQRIAIARCLLKDPKIVIFDEATSDSKTEYLFQ--KAVEDLRK-NR 201

Query: 190 TMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
           T++++ H        A+ ++ ++ G+IVE+G  +++
Sbjct: 202 TLIIIAHR---TISSAESIILLNKGKIVEKGTHKDL 234


>2d2eA [x.x.x] SUFC PROTEIN
          Length = 239

 Score = 70.5 bits (171), Expect = 5e-15
 Identities = 57/223 (25%), Positives = 108/223 (48%), Gaps = 6/223 (2%)

Query: 5   IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDF--QEGEVV 62
           + IR+L        +LKG++L V  GE   ++GP+G+GKSTL + +    ++  + GE++
Sbjct: 3   LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL 62

Query: 63  VDGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXX 122
           +DG N+ +       R+ + + F Q+ + P +T+   + LA ++ +              
Sbjct: 63  LDGENILELSPDERARKGLFLAF-QYPVVPGVTIANFLRLA-LQAKLGREVGVAEFWTKV 120

Query: 123 XXRVGILDQARKYPAQ-LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVM 181
              + +LD    Y ++ L+ G+++R  I + L +EP   + DE  S LD + +  V   +
Sbjct: 121 KKALELLDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGV 180

Query: 182 RDLAQGGMTMVVVTHEMGFAREV-ADRVVFMDGGQIVEEGRPE 223
             +       +V+TH       +  D+V  M  G++V  G PE
Sbjct: 181 NAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPE 223


>2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 247

 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 61/229 (26%), Positives = 99/229 (43%), Gaps = 13/229 (5%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           ++ I++LH       +L+G+ L+V PGE   I+GP+GSGKSTL  T+   ED++     V
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNL------FPHMTVLENVTLAPMRVRRWPRXXXXX 117
           +    KD  AL    R    +F  F          +   L+    A    R         
Sbjct: 61  E-FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 118 XXXXXXXRVGILDQ-----ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE 172
                  ++ +L        R      SGG+++R  I +   +EP++ + DE  S LD +
Sbjct: 120 FQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDID 179

Query: 173 MVGEVLDVMRDLAQGGMTMVVVTHEMGFAREV-ADRVVFMDGGQIVEEG 220
            +  V D +  L  G  + ++VTH       +  D V  +  G+IV+ G
Sbjct: 180 ALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 228


>2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 70.1 bits (170), Expect = 6e-15
 Identities = 61/229 (26%), Positives = 99/229 (43%), Gaps = 13/229 (5%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           ++ I++LH       +L+G+ L+V PGE   I+GP+GSGKSTL  T+   ED++     V
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNL------FPHMTVLENVTLAPMRVRRWPRXXXXX 117
           +    KD  AL    R    +F  F          +   L+    A    R         
Sbjct: 61  E-FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 118 XXXXXXXRVGILDQ-----ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE 172
                  ++ +L        R      SGG+++R  I +   +EP++ + DE  S LD +
Sbjct: 120 FQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDID 179

Query: 173 MVGEVLDVMRDLAQGGMTMVVVTHEMGFAREV-ADRVVFMDGGQIVEEG 220
            +  V D +  L  G  + ++VTH       +  D V  +  G+IV+ G
Sbjct: 180 ALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 228


>2ghiD [x.x.x] TRANSPORT PROTEIN
          Length = 224

 Score = 68.2 bits (165), Expect = 2e-14
 Identities = 52/211 (24%), Positives = 98/211 (46%), Gaps = 26/211 (12%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           LK I+  +  G    ++G +GSGKST+ + + R  D  EG++ + G NV        +R 
Sbjct: 21  LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYNR-NSIRS 78

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ- 138
            +G+V Q   LF + T+  N+    +                      + D     P + 
Sbjct: 79  IIGIVPQDTILF-NETIKYNILYGKLDAT-------DEEVIKATKSAQLYDFIEALPKKW 130

Query: 139 ----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
               LSGG++QR+AIAR L  +PKI++FD+  +            + +   +   T++++
Sbjct: 131 DTIVLSGGERQRIAIARCLLKDPKIVIFDDSKTEY----------LFQKAVEDNRTLIII 180

Query: 195 THEMGFAREVADRVVFMDGGQIVEEGRPEEI 225
            H +      A+ ++ ++ G+IVE+G  +++
Sbjct: 181 AHRLSTISS-AESIILLNKGKIVEKGTHKDL 210


>2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
          Length = 230

 Score = 67.8 bits (164), Expect = 3e-14
 Identities = 59/216 (27%), Positives = 96/216 (44%), Gaps = 25/216 (11%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L GI   +  G  + ++G  G GKS+L+  +    D  EG V + G              
Sbjct: 20  LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG-------------- 65

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV---GILDQARKYP 136
            V  V QQ  +  + ++ EN+         + R             +   G   +  +  
Sbjct: 66  SVAYVPQQAWI-QNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKG 124

Query: 137 AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGM----TMV 192
             LSGGQ+QRV++ARA+     I LFD+P SA+D  +   + + +  +   GM    T +
Sbjct: 125 VNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV--IGPKGMLKNKTRI 182

Query: 193 VVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTR 228
           +VTH M +  +V D ++ M GG+I E G  +E+  R
Sbjct: 183 LVTHSMSYLPQV-DVIIVMSGGKISEMGSYQELLAR 217


>2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 66.2 bits (160), Expect = 9e-14
 Identities = 60/228 (26%), Positives = 99/228 (43%), Gaps = 13/228 (5%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           ++ I++LH       +L+G+ L+V PGE   I+GP+GSGKSTL  T+   ED++     V
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNL------FPHMTVLENVTLAPMRVRRWPRXXXXX 117
           +    KD  AL    R    +F  F          +   L+    A    R         
Sbjct: 61  E-FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 118 XXXXXXXRVGILDQ-----ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE 172
                  ++ +L        R      SGG+++R  I +   +EP++ + DE + +LD +
Sbjct: 120 FQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE-SDSLDID 178

Query: 173 MVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEG 220
            +  V D +  L  G  + ++VTH         D V  +  G+IV+ G
Sbjct: 179 ALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSG 226


>2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 243

 Score = 65.1 bits (157), Expect = 2e-13
 Identities = 60/229 (26%), Positives = 99/229 (43%), Gaps = 14/229 (6%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           ++ I++LH       +L+G+ L+V PGE   I+GP+GSGKSTL  T+   ED++     V
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNL------FPHMTVLENVTLAPMRVRRWPRXXXXX 117
           +    KD  AL    R    +F  F          +   L+    A    R         
Sbjct: 61  E-FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 118 XXXXXXXRVGILDQ-----ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE 172
                  ++ +L        R      SGG+++R  I +   +EP++ + DE +  LD +
Sbjct: 120 FQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE-SDGLDID 178

Query: 173 MVGEVLDVMRDLAQGGMTMVVVTHEMGFAREV-ADRVVFMDGGQIVEEG 220
            +  V D +  L  G  + ++VTH       +  D V  +  G+IV+ G
Sbjct: 179 ALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 227


>3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 593

 Score = 63.2 bits (152), Expect = 8e-13
 Identities = 54/189 (28%), Positives = 87/189 (46%), Gaps = 20/189 (10%)

Query: 26  EVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRREVGMVF 85
           E+  GE + I+GP+G GK+T ++ +  +E+  EG+V  D L V       +   E G V+
Sbjct: 364 EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD-LTVAYKPQYIKAEYE-GTVY 421

Query: 86  QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLSGGQQQ 145
           +  +      +  N     +                    +GI+D   +    LSGG+ Q
Sbjct: 422 ELLSKIDSSKLNSNFYKTEL-----------------LKPLGIIDLYDRNVEDLSGGELQ 464

Query: 146 RVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQ-GGMTMVVVTHEMGFAREV 204
           RVAIA  L  +  I L DEP++ LD E    V   +R L +    T +VV H++     V
Sbjct: 465 RVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYV 524

Query: 205 ADRVVFMDG 213
           +DR++  +G
Sbjct: 525 SDRLIVFEG 533



 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 138 QLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHE 197
           QLSGG+ QRVAIA AL  +     FDEP+S LD     +V  V+R LA  G  ++VV H+
Sbjct: 214 QLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHD 273

Query: 198 MGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERT--RSFLQRVL 242
           +     ++D +  + G     E     IF++PK  R     FLQ  L
Sbjct: 274 LAVLDYLSDVIHVVYG-----EPGVYGIFSKPKGTRNGINEFLQGYL 315


>2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 241

 Score = 61.6 bits (148), Expect = 2e-12
 Identities = 59/229 (25%), Positives = 97/229 (42%), Gaps = 16/229 (6%)

Query: 4   IIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVV 63
           ++ I++LH       +L+G+ L+V PGE   I+GP+GSGKSTL  T+   ED++     V
Sbjct: 1   MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV 60

Query: 64  DGLNVKDDRALREVRREVGMVFQQFNL------FPHMTVLENVTLAPMRVRRWPRXXXXX 117
           +    KD  AL    R    +F  F          +   L+    A    R         
Sbjct: 61  E-FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD 119

Query: 118 XXXXXXXRVGILDQ-----ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPE 172
                  ++ +L        R      SGG+++R  I +   +EP++ + DE     D +
Sbjct: 120 FQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESD---DID 176

Query: 173 MVGEVLDVMRDLAQGGMTMVVVTHEMGFAREV-ADRVVFMDGGQIVEEG 220
            +  V D +  L  G  + ++VTH       +  D V  +  G+IV+ G
Sbjct: 177 ALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG 225


>1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 496

 Score = 60.1 bits (144), Expect = 7e-12
 Identities = 47/184 (25%), Positives = 82/184 (44%), Gaps = 8/184 (4%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L+ I+L++  G+ + ++G SGSGKST+   I R  D  EG +++DG +++ +  L  +R 
Sbjct: 293 LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLR-EYTLASLRN 351

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQA-----RK 134
           +V +V Q  +LF + TV  N+  A        +             +  +D        +
Sbjct: 352 QVALVSQNVHLF-NDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGE 410

Query: 135 YPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
               LS               +  I++ DE TSALD E    +   + +L Q   T +V+
Sbjct: 411 NGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVI 469

Query: 195 THEM 198
            H +
Sbjct: 470 AHRL 473


>3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 572

 Score = 60.1 bits (144), Expect = 7e-12
 Identities = 47/184 (25%), Positives = 82/184 (44%), Gaps = 8/184 (4%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L+ I+L++  G+ + ++G SGSGKST+   I R  D  EG +++DG +++ +  L  +R 
Sbjct: 350 LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLR-EYTLASLRN 408

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQA-----RK 134
           +V +V Q  +LF + TV  N+  A        +             +  +D        +
Sbjct: 409 QVALVSQNVHLF-NDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGE 467

Query: 135 YPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
               LS               +  I++ DE TSALD E    +   + +L Q   T +V+
Sbjct: 468 NGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVI 526

Query: 195 THEM 198
            H +
Sbjct: 527 AHRL 530


>2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 251

 Score = 59.7 bits (143), Expect = 9e-12
 Identities = 61/231 (26%), Positives = 106/231 (45%), Gaps = 16/231 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           +LK I  ++A G+K ++ G +G+GK+TL+  +N  E    G V + G   K   +   VR
Sbjct: 17  ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKVGYSAETVR 76

Query: 79  REVGMV-------FQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQ 131
           + +G V       FQ+      + V+ +     + V +                VG   +
Sbjct: 77  QHIGFVSHSLLEKFQEGERV--IDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGSA-K 133

Query: 132 ARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
           A++Y   LS G++QRV IARAL  +P++++ DEP + LD                   T+
Sbjct: 134 AQQYIGYLSTGEKQRV-IARALG-QPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTL 191

Query: 192 VV-VTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQRV 241
            + VTH +        +++ +  GQ +++G  E+I T    E +R F + V
Sbjct: 192 AIYVTHFIEEITANFSKILLLKDGQSIQQGAVEDILT---SENSRFFQKNV 239


>1yqtA [x.x.x] RNASE L INHIBITOR
          Length = 507

 Score = 58.9 bits (141), Expect = 1e-11
 Identities = 54/185 (29%), Positives = 86/185 (46%), Gaps = 21/185 (11%)

Query: 26  EVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRREVGMVF 85
           E+  GE + I+GP+G GK+T ++    +E+  EG++  D L V       +   E G V+
Sbjct: 284 EIKKGEVIGIVGPNGIGKTTFVKLAG-VEEPTEGKIEWD-LTVAYKPQYIKADYE-GTVY 340

Query: 86  QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLSGGQQQ 145
           +  +      +  N     +                    +GI+D   +   +LSGG+ Q
Sbjct: 341 ELLSKIDASKLNSNFYKTEL-----------------LKPLGIIDLYDREVNELSGGELQ 383

Query: 146 RVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVA 205
           RVAIA  L  +  I L DEP++ LD E    V   +R L +   T +VV H++     V+
Sbjct: 384 RVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDV-LIDYVS 442

Query: 206 DRVVF 210
           DR+VF
Sbjct: 443 DRLVF 447



 Score = 48.9 bits (115), Expect = 2e-08
 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGG+ QRVAIA AL        FDEP+S LD          +R L++ G +++VV H++
Sbjct: 135 LSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDL 194

Query: 199 GFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEER 233
                ++D +  + G     E     IF++PK  R
Sbjct: 195 AVLDYLSDIIHVVYG-----EPGVYGIFSQPKGTR 224


>2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 864

 Score = 58.2 bits (139), Expect = 3e-11
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 11/113 (9%)

Query: 139 LSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
           LSGG+ QRV +A  L        + + DEPT+ L  + +  +LDV+  L   G T++V+ 
Sbjct: 742 LSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIE 801

Query: 196 HEMGFAREVADRVVFMD------GGQIVEEGRPEEIFTRPKEERTRSFLQRVL 242
           H +   +  AD ++ +       GGQIV  G PEE+    KE  T  +L+ +L
Sbjct: 802 HNLDVIK-TADYIIDLGPEGGDRGGQIVAVGTPEEV-AEVKESHTGRYLKPIL 852



 Score = 33.9 bits (76), Expect = 5e-04
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 15/97 (15%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLF--DEPTSALDPEMVGEVLDVM--RDLAQGGMTMVVV 194
           LSGG+ QR+ +A  +      +L+  DEP+  L       ++  +  RDL   G T++VV
Sbjct: 407 LSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSRDL---GNTLIVV 463

Query: 195 THEMGFAREVADRVVFMD------GGQIVEEGRPEEI 225
            H+       AD ++ +       GG++V  G PEE+
Sbjct: 464 EHDEDTL--AADYLIDIGPGAGIHGGEVVAAGTPEEV 498


>2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 884

 Score = 58.2 bits (139), Expect = 3e-11
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 11/113 (9%)

Query: 139 LSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
           LSGG+ QRV +A  L        + + DEPT+ L  + +  +LDV+  L   G T++V+ 
Sbjct: 762 LSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIE 821

Query: 196 HEMGFAREVADRVVFMD------GGQIVEEGRPEEIFTRPKEERTRSFLQRVL 242
           H +   +  AD ++ +       GGQIV  G PEE+    KE  T  +L+ +L
Sbjct: 822 HNLDVIK-TADYIIDLGPEGGDRGGQIVAVGTPEEV-AEVKESHTGRYLKPIL 872



 Score = 33.9 bits (76), Expect = 5e-04
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 15/97 (15%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLF--DEPTSALDPEMVGEVLDVM--RDLAQGGMTMVVV 194
           LSGG+ QR+ +A  +      +L+  DEP+  L       ++  +  RDL   G T++VV
Sbjct: 427 LSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSRDL---GNTLIVV 483

Query: 195 THEMGFAREVADRVVFMD------GGQIVEEGRPEEI 225
            H+       AD ++ +       GG++V  G PEE+
Sbjct: 484 EHDEDTL--AADYLIDIGPGAGIHGGEVVAAGTPEEV 518


>2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 57.4 bits (137), Expect = 4e-11
 Identities = 60/224 (26%), Positives = 102/224 (45%), Gaps = 14/224 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           +LK I  ++A G+K ++ G +G+GK+TL+  +N  E    G V + G   K   +   VR
Sbjct: 16  ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG---KPGYSAETVR 72

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
           + +G V    +L       E V    + +                  VG   +A++Y   
Sbjct: 73  QHIGFV--SHSLLEKFQEGERVI--DVVISGAIDDEIRNEAHQLLKLVGSA-KAQQYIGY 127

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV-VTHE 197
           LS G++QRV IARAL  +P++++ DEP + LD                   T+ + VTH 
Sbjct: 128 LSTGEKQRV-IARALG-QPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHF 185

Query: 198 MGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQRV 241
           +        +++ +  GQ +++G  E+I T    E +R F + V
Sbjct: 186 IEEITANFSKILLLKDGQSIQQGAVEDILT---SENSRFFQKNV 226


>2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066
          Length = 261

 Score = 55.8 bits (133), Expect = 1e-10
 Identities = 48/179 (26%), Positives = 86/179 (48%), Gaps = 14/179 (7%)

Query: 20  LKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRR 79
           L+ I+LEV  GEK++I+GP+GSGK+TL+R I+ L  +  G + ++G+ V      R++R 
Sbjct: 21  LENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPY-SGNIFINGMEV------RKIRN 72

Query: 80  EVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQL 139
            +         +     + ++      ++   R               IL   R+   +L
Sbjct: 73  YIRYSTNLPEAYEIGVTVNDIVYLYEELKGLDRDLFLEMLKALKLGEEIL---RRKLYKL 129

Query: 140 SGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           S GQ   V  + ALA +P+I+  DEP   +D      +   +++  + G   ++VTHE+
Sbjct: 130 SAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG---ILVTHEL 185


>2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 301

 Score = 55.8 bits (133), Expect = 1e-10
 Identities = 27/85 (31%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 155 MEPKIMLFDEPTSALDPEMVGEV-LDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDG 213
           +EP + L DEP S LD  +  ++ +++ R   + G TM+ VTH+   A  +AD++V +D 
Sbjct: 79  VEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA 138

Query: 214 GQIVEEGRPEEIFTRPKEERTRSFL 238
           G++ + G+P E++  P +     F+
Sbjct: 139 GRVAQVGKPLELYHYPADRFVAGFI 163



 Score = 53.5 bits (127), Expect = 6e-10
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 5  IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
          ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3  VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65 GLNVKDDRALREVRREVGMV 84
             + D        R VGMV
Sbjct: 63 EKRMND---TPPAERGVGMV 79


>2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 299

 Score = 53.5 bits (127), Expect = 6e-10
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 5  IRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVD 64
          ++++N+ K +G + V K I+L++  GE +V +GPSG GKSTL+R I  LE    G++ + 
Sbjct: 3  VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 62

Query: 65 GLNVKDDRALREVRREVGMV 84
             + D        R VGMV
Sbjct: 63 EKRMND---TPPAERGVGMV 79



 Score = 51.6 bits (122), Expect = 2e-09
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 4/85 (4%)

Query: 155 MEPKIMLFDEPT-SALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDG 213
           +EP + L DEP  +AL  +M  E+  + + L   G TM+ VTH+   A  +AD++V +D 
Sbjct: 79  VEPSVFLLDEPLDAALRVQMRIEISRLHKRL---GRTMIYVTHDQVEAMTLADKIVVLDA 135

Query: 214 GQIVEEGRPEEIFTRPKEERTRSFL 238
           G++ + G+P E++  P +     F+
Sbjct: 136 GRVAQVGKPLELYHYPADRFVAGFI 160


>2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 231

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 53/231 (22%), Positives = 92/231 (39%), Gaps = 22/231 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 14  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------- 60

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
             +    Q   + P  T+ EN+        R+              +    D        
Sbjct: 61  -RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGIT 118

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT +M
Sbjct: 119 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM 178

Query: 199 GFAREVADRVVFMDGGQIVEEGRPEEI------FTRPKEERTRSFLQRVLH 243
              ++ AD+++ +  G     G   E+      F +   ER  S L   LH
Sbjct: 179 EHLKK-ADKILILHEGSSYFYGTFSELQNLRDSFDQFSAERRNSILTETLH 228


>2qi9C [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
          Length = 240

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 58/211 (27%), Positives = 93/211 (44%), Gaps = 20/211 (9%)

Query: 26  EVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRREVGMVF 85
           EV  GE L ++GP+G+GKSTL+    R     +G +   G  ++   A +       +  
Sbjct: 20  EVRAGEILHLVGPNGAGKSTLLA---RAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQ 76

Query: 86  QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLSGGQQQ 145
           QQ   F    V   +TL      R                + + D+  +   QLSGG+ Q
Sbjct: 77  QQTPPFA-TPVWHYLTLHQHDKTR------TELLNDVAGALALDDKLGRSTNQLSGGEWQ 129

Query: 146 RVAIAR-ALAMEP------KIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           RV +A   L + P      +++L DEP S LD      +  ++  L+Q G+  +V +H++
Sbjct: 130 RVRLAAVVLQITPQANPAGQLLLLDEPNS-LDVAQQSALDKILSALSQQGLA-IVSSHDL 187

Query: 199 GFAREVADRVVFMDGGQIVEEGRPEEIFTRP 229
                 A R   + GG++   GR EE+ T P
Sbjct: 188 NHTLRHAHRAWLLKGGKLA-SGRREEVLTPP 217


>2ix3A [x.x.x] ELONGATION FACTOR 3
          Length = 972

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 47/201 (23%), Positives = 86/201 (42%), Gaps = 26/201 (12%)

Query: 14  FGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRA 73
           +G   +L    L +    +  I GP+G GKSTL+R I   +        VDG   +++  
Sbjct: 439 YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQ--------VDGFPTQEECR 490

Query: 74  LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR 133
              V  ++             +VL+ V  + +  +                  G  D+  
Sbjct: 491 TVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEMI 536

Query: 134 KYP-AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
             P + LSGG + ++A+ARA+     I+L DEPT+ LD   V  +++ +      G+T +
Sbjct: 537 AMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSI 593

Query: 193 VVTHEMGFAREVADRVVFMDG 213
            ++H+  F   V + ++  +G
Sbjct: 594 TISHDSVFLDNVCEYIINYEG 614



 Score = 45.1 bits (105), Expect = 2e-07
 Identities = 20/78 (25%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ ++ +A      P +++ DEPT+ LD + +G +   +++   G   ++++TH  
Sbjct: 896 LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSA 952

Query: 199 GFAREVADRVVFMDGGQI 216
            F + + + V  +  G++
Sbjct: 953 EFTKNLTEEVWAVKDGRM 970


>2iwhB [x.x.x] ELONGATION FACTOR 3A
          Length = 980

 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 47/201 (23%), Positives = 86/201 (42%), Gaps = 26/201 (12%)

Query: 14  FGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRA 73
           +G   +L    L +    +  I GP+G GKSTL+R I   +        VDG   +++  
Sbjct: 443 YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQ--------VDGFPTQEECR 494

Query: 74  LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR 133
              V  ++             +VL+ V  + +  +                  G  D+  
Sbjct: 495 TVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEMI 540

Query: 134 KYP-AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
             P + LSGG + ++A+ARA+     I+L DEPT+ LD   V  +++ +      G+T +
Sbjct: 541 AMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSI 597

Query: 193 VVTHEMGFAREVADRVVFMDG 213
            ++H+  F   V + ++  +G
Sbjct: 598 TISHDSVFLDNVCEYIINYEG 618



 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 21/82 (25%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ ++ +A      P +++ DEPT+ LD + +G +   +++   G   ++++TH  
Sbjct: 900 LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSA 956

Query: 199 GFAREVADRVVFMDGGQIVEEG 220
            F + + + V  +  G++   G
Sbjct: 957 EFTKNLTEEVWAVKDGRMTPSG 978


>1l7vC [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
          Length = 224

 Score = 50.4 bits (119), Expect = 5e-09
 Identities = 58/211 (27%), Positives = 92/211 (43%), Gaps = 20/211 (9%)

Query: 26  EVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVRREVGMVF 85
           EV  GE L ++GP+G+GKSTL+    R     +G +   G  ++   A +       +  
Sbjct: 20  EVRAGEILHLVGPNGAGKSTLLA---RAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQ 76

Query: 86  QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLSGGQQQ 145
           QQ   F    V   +TL      R                + + D+  +   QLSGG+ Q
Sbjct: 77  QQTPPFA-TPVWHYLTLHQHDKTR------TELLNDVAGALALDDKLGRSTNQLSGGEWQ 129

Query: 146 RVAIAR-ALAMEP------KIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           RV +A   L + P      +++L DEP S LD      +  ++  L Q G+  +V +H++
Sbjct: 130 RVRLAAVVLQITPQANPAGQLLLLDEPNS-LDVAQQSALDKILSALCQQGLA-IVSSHDL 187

Query: 199 GFAREVADRVVFMDGGQIVEEGRPEEIFTRP 229
                 A R   + GG++   GR EE+ T P
Sbjct: 188 NHTLRHAHRAWLLKGGKLA-SGRREEVLTPP 217


>2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 249

 Score = 48.9 bits (115), Expect = 2e-08
 Identities = 54/236 (22%), Positives = 92/236 (38%), Gaps = 27/236 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 28  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------- 74

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
             +    Q   + P  T+ EN+        R+              +    D        
Sbjct: 75  -RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGIT 132

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT +M
Sbjct: 133 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM 192

Query: 199 GFAREVADRVVFMDGGQIVEEGRPEEIFT-RP----------KEERTRSFLQRVLH 243
              ++ AD+++ +  G     G   E+   RP            ER  S L   LH
Sbjct: 193 EHLKK-ADKILILHEGSSYFYGTFSELQNLRPXXXXXXXXXXXAERRNSILTETLH 247


>1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER
          Length = 200

 Score = 47.8 bits (112), Expect = 3e-08
 Identities = 41/183 (22%), Positives = 89/183 (48%), Gaps = 11/183 (6%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VL+ I + +  G  +   GP+G GK+TL++TI+      +GE++ +G+ +   +      
Sbjct: 16  VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFL 75

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
            E  +V ++ ++  ++  +   +L  ++V +                V +LD  +K   +
Sbjct: 76  PEEIIVPRKISVEDYLKAV--ASLYGVKVNK-------NEIMDALESVEVLDLKKKL-GE 125

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-DVMRDLAQGGMTMVVVTHE 197
           LS G  +RV +A  L +  +I + D+P  A+D +   +VL  ++  L + G+ ++    E
Sbjct: 126 LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREE 185

Query: 198 MGF 200
           + +
Sbjct: 186 LSY 188


>1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 76

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 77  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 136

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 137 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 196

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 197 VTSKMEHLRK-ADKILILHQG 216


>1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 256

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 29  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 71

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 72  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 131

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 132 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 191

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 192 VTSKMEHLRK-ADKILILHQG 211


>1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 273

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 46  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 88

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 89  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 148

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 149 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 208

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 209 VTSKMEHLRK-ADKILILHQG 228


>1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 44  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 86

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 87  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 146

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 147 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 206

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 207 VTSKMEHLRK-ADKILILHQG 226


>1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 44  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 86

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 87  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 146

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 147 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 206

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 207 VTSKMEHLRK-ADKILILHQG 226


>1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 263

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 33  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 75

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 76  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 135

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 136 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 195

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 196 VTSKMEHLRK-ADKILILHQG 215


>1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 77

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 78  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 137

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 138 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 197

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 198 VTSKMEHLRK-ADKILILHQG 217


>1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 77

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 78  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 137

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 138 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 197

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 198 VTSKMEHLRK-ADKILILHQG 217


>1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 76

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 77  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 136

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 137 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 196

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 197 VTSKMEHLRK-ADKILILHQG 216


>1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 37  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 79

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 80  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 139

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 140 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 199

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 200 VTSKMEHLRK-ADKILILHQG 219


>1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 37  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 79

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 80  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 139

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 140 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 199

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 200 VTSKMEHLRK-ADKILILHQG 219


>1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 36  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 78

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 79  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 138

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 139 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 198

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 199 VTSKMEHLRK-ADKILILHQG 218


>1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 76

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 77  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 136

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 137 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 196

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 197 VTSKMEHLRK-ADKILILHQG 216


>1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 36  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 78

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 79  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 138

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 139 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 198

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 199 VTSKMEHLRK-ADKILILHQG 218


>1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 37  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 79

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 80  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 139

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 140 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 199

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 200 VTSKMEHLRK-ADKILILHQG 219


>1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 77

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 78  KHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 137

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 138 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 197

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 198 VTSKMEHLRK-ADKILILHQG 217


>2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 224

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 18/210 (8%)

Query: 7   IRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGL 66
           + N+  ++G   VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G 
Sbjct: 9   MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR 68

Query: 67  NVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRV 126
                               QF+     T+ EN+        R+              + 
Sbjct: 69  I---------------SFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKF 113

Query: 127 GILDQA--RKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDL 184
              D     +    LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +     
Sbjct: 114 AEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK 173

Query: 185 AQGGMTMVVVTHEMGFAREVADRVVFMDGG 214
                T ++VT +M   ++ AD+++ +  G
Sbjct: 174 LMANKTRILVTSKMEHLKK-ADKILILHEG 202


>2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 54/239 (22%), Positives = 94/239 (39%), Gaps = 31/239 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 33  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------- 79

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
             +    Q   + P  T+ EN+        R+              +    D        
Sbjct: 80  -RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNI-VLGIT 136

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT +M
Sbjct: 137 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM 196

Query: 199 GFAREVADRVVFMDGGQIVEEG--------RPE------EIFTRPKEERTRSFLQRVLH 243
              ++ AD+++ +  G     G        RP+      + F +   ER  S L   LH
Sbjct: 197 EHLKK-ADKILILHEGSSYFYGTFSELQNLRPDFSSKLMDSFDQFSAERRNSILTETLH 254


>2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 253

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 53/238 (22%), Positives = 92/238 (38%), Gaps = 31/238 (13%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 30  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------- 76

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
             +    Q   + P  T+ EN+        R+              +    D        
Sbjct: 77  -RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNI--VLIT 132

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT +M
Sbjct: 133 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM 192

Query: 199 GFAREVADRVVFMDGGQIVEEGRPEEI-------------FTRPKEERTRSFLQRVLH 243
              ++ AD+++ +  G     G   E+             F +   ER  S L   LH
Sbjct: 193 EHLKK-ADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLH 249


>1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 260

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 25/202 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 30  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 72

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYP 136
           +  G V    QF+     T+ EN+ ++ +    +                   +Q     
Sbjct: 73  KHSGRVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVL 131

Query: 137 AQ----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
            +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T +
Sbjct: 132 GEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRI 191

Query: 193 VVTHEMGFAREVADRVVFMDGG 214
           +VT +M   R+ AD+++ +  G
Sbjct: 192 LVTSKMEHLRK-ADKILILHQG 212


>1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 25/202 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 77

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYP 136
           +  G V    QF+     T+ EN+ ++ +    +                   +Q     
Sbjct: 78  KHSGRVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVL 136

Query: 137 AQ----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
            +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T +
Sbjct: 137 GEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRI 196

Query: 193 VVTHEMGFAREVADRVVFMDGG 214
           +VT +M   R+ AD+++ +  G
Sbjct: 197 LVTSKMEHLRK-ADKILILHQG 217


>1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 25/202 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 77

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYP 136
           +  G V    QF+     T+ EN+ ++ +    +                   +Q     
Sbjct: 78  KHSGRVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVL 136

Query: 137 AQ----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
            +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T +
Sbjct: 137 GEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRI 196

Query: 193 VVTHEMGFAREVADRVVFMDGG 214
           +VT +M   R+ AD+++ +  G
Sbjct: 197 LVTSKMEHLRK-ADKILILHQG 217


>1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 47.0 bits (110), Expect = 6e-08
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 25/202 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 76

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYP 136
           +  G V    QF+     T+ EN+ ++ +    +                   +Q     
Sbjct: 77  KHSGRVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVL 135

Query: 137 AQ----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
            +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T +
Sbjct: 136 GEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRI 195

Query: 193 VVTHEMGFAREVADRVVFMDGG 214
           +VT +M   R+ AD+++ +  G
Sbjct: 196 LVTSKMEHLRK-ADKILILHQG 216


>1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 46.6 bits (109), Expect = 8e-08
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+L +  GE L I G +GSGK++L+  I  L + +  E ++               
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII--------------- 76

Query: 79  REVGMVF--QQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--R 133
           +  G V    QF+     T+ EN+         R+              +    D     
Sbjct: 77  KHSGRVSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG 136

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
           +    LSGGQ+ R+++ARA+  +  + L D P   LD     +V +          T ++
Sbjct: 137 EGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL 196

Query: 194 VTHEMGFAREVADRVVFMDGG 214
           VT +M   R+ AD+++ +  G
Sbjct: 197 VTSKMEHLRK-ADKILILHQG 216


>2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 835

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 138 QLSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
           +LSGG+ QR+ +A  L    +   + + DEPT+ L P  V  +   +  L   G T++ V
Sbjct: 723 ELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAV 782

Query: 195 THEMGFAREVADRVVFM------DGGQIVEEGRPEEI 225
            H+M      +D V+ +      DGG++V +G P E+
Sbjct: 783 EHKMQVV-AASDWVLDIGPGAGEDGGRLVAQGTPAEV 818



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 139 LSGGQQQRVAIARALAME--PKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
           LS G+ QR+ +A  L       + + DEP++ L P     +L  + +L +GG ++ VV H
Sbjct: 373 LSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEH 432

Query: 197 EMGFAREVADRVVFM------DGGQIVEEGRPEEIFTRPKEERTRSFL 238
           ++   R  AD +V +       GG+I+  G PE +   P E +T  +L
Sbjct: 433 DLDVIRR-ADWLVDVGPEAGEKGGEILYSGPPEGLKHVP-ESQTGQYL 478


>2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 806

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 138 QLSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
           +LSGG+ QR+ +A  L    +   + + DEPT+ L P  V  +   +  L   G T++ V
Sbjct: 694 ELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAV 753

Query: 195 THEMGFAREVADRVVFM------DGGQIVEEGRPEEI 225
            H+M      +D V+ +      DGG++V +G P E+
Sbjct: 754 EHKMQVV-AASDWVLDIGPGAGEDGGRLVAQGTPAEV 789



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 139 LSGGQQQRVAIARALAME--PKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
           LS G+ QR+ +A  L       + + DEP++ L P     +L  + +L +GG ++ VV H
Sbjct: 369 LSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEH 428

Query: 197 EMGFAREVADRVVFM------DGGQIVEEGRPEEIFTRPKEERTRSFL 238
           ++   R  AD +V +       GG+I+  G PE +   P E +T  +L
Sbjct: 429 DLDVIRR-ADWLVDVGPEAGEKGGEILYSGPPEGLKHVP-ESQTGQYL 474


>2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 814

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 138 QLSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
           +LSGG+ QR+ +A  L    +   + + DEPT+ L P  V  +   +  L   G T++ V
Sbjct: 702 ELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAV 761

Query: 195 THEMGFAREVADRVVFM------DGGQIVEEGRPEEI 225
            H+M      +D V+ +      DGG++V +G P E+
Sbjct: 762 EHKMQVV-AASDWVLDIGPGAGEDGGRLVAQGTPAEV 797



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 139 LSGGQQQRVAIARALAME--PKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
           LS G+ QR+ +A  L       + + DEP++ L P     +L  + +L +GG ++ VV H
Sbjct: 371 LSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEH 430

Query: 197 EMGFAREVADRVVFM------DGGQIVEEGRPEEIFTRPKEERTRSFL 238
           ++   R  AD +V +       GG+I+  G PE +   P E +T  +L
Sbjct: 431 DLDVIRR-ADWLVDVGPEAGEKGGEILYSGPPEGLKHVP-ESQTGQYL 476


>2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 813

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 138 QLSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
           +LSGG+ QR+ +A  L    +   + + DEPT+ L P  V  +   +  L   G T++ V
Sbjct: 701 ELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAV 760

Query: 195 THEMGFAREVADRVVFM------DGGQIVEEGRPEEI 225
            H+M      +D V+ +      DGG++V +G P E+
Sbjct: 761 EHKMQVV-AASDWVLDIGPGAGEDGGRLVAQGTPAEV 796



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 139 LSGGQQQRVAIARALAME--PKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
           LS G+ QR+ +A  L       + + DEP++ L P     +L  + +L +GG ++ VV H
Sbjct: 373 LSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEH 432

Query: 197 EMGFAREVADRVVFM------DGGQIVEEGRPEEIFTRPKEERTRSFL 238
           ++   R  AD +V +       GG+I+  G PE +   P E +T  +L
Sbjct: 433 DLDVIRR-ADWLVDVGPEAGEKGGEILYSGPPEGLKHVP-ESQTGQYL 478


>2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 815

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 138 QLSGGQQQRVAIARALAMEPK---IMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVV 194
           +LSGG+ QR+ +A  L    +   + + DEPT+ L P  V  +   +  L   G T++ V
Sbjct: 703 ELSGGEAQRIKLATELRRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAV 762

Query: 195 THEMGFAREVADRVVFM------DGGQIVEEGRPEEI 225
            H+M      +D V+ +      DGG++V +G P E+
Sbjct: 763 EHKMQVV-AASDWVLDIGPGAGEDGGRLVAQGTPAEV 798



 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 139 LSGGQQQRVAIARALAME--PKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
           LS G+ QR+ +A  L       + + DEP++ L P     +L  + +L +GG ++ VV H
Sbjct: 370 LSPGELQRLRLATQLYSNLFGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEH 429

Query: 197 EMGFAREVADRVVFM------DGGQIVEEGRPEEIFTRPKEERTRSFL 238
           ++   R  AD +V +       GG+I+  G PE +   P E +T  +L
Sbjct: 430 DLDVIRR-ADWLVDVGPEAGEKGGEILYSGPPEGLKHVP-ESQTGQYL 475


>1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 45.1 bits (105), Expect = 2e-07
 Identities = 44/196 (22%), Positives = 83/196 (42%), Gaps = 24/196 (12%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 38  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 86

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQ 138
                   QF+     T+ EN+ +A +    +                 + +   K    
Sbjct: 87  ----SFCSQFSWIMPGTIKENI-IAGVSYDEY-------RYRSVIKACQLEEDISKIVLT 134

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT +M
Sbjct: 135 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM 194

Query: 199 GFAREVADRVVFMDGG 214
              ++ AD+++ +  G
Sbjct: 195 EHLKK-ADKILILHEG 209


>1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 268

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 44/197 (22%), Positives = 80/197 (40%), Gaps = 17/197 (8%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 38  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 86

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQARKYPA 137
                   QF+     T+ EN+         R+              +    D       
Sbjct: 87  ----SFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEI 142

Query: 138 QLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHE 197
            LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT +
Sbjct: 143 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 202

Query: 198 MGFAREVADRVVFMDGG 214
           M   ++ AD+++ +  G
Sbjct: 203 MEHLKK-ADKILILHEG 218


>2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 216

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 45/202 (22%), Positives = 82/202 (40%), Gaps = 18/202 (8%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G   VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G         
Sbjct: 17  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI------- 69

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQA-- 132
                       QF+     T+ EN+        R+              +    D    
Sbjct: 70  --------SFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVL 121

Query: 133 RKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
            +    LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T +
Sbjct: 122 GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 181

Query: 193 VVTHEMGFAREVADRVVFMDGG 214
           +VT +M   ++ AD+++ +  G
Sbjct: 182 LVTSKMEHLKK-ADKILILHEG 202


>2ix8A [x.x.x] ELONGATION FACTOR 3A
          Length = 953

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ ++ +A      P +++ DEPT+ LD + +G +   +++   G   ++++TH  
Sbjct: 874 LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSA 930

Query: 199 GFAREVADRVVFMDGGQ 215
            F + + + V  +  G+
Sbjct: 931 EFTKNLTEEVWAVKDGR 947



 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 28/200 (14%)

Query: 14  FGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRA 73
           +G   +L    L +    +  I GP+G GKSTL    N       G+V  DG   +++  
Sbjct: 431 YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIAN-------GQV--DGFPTQEECR 481

Query: 74  LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR 133
              V  ++             +VL+ V  + +  +                  G  D+  
Sbjct: 482 TVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEIA 527

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
              A LSGG + ++A+ARA+     I+L DEPT+ LD   V  +++ +      G+T + 
Sbjct: 528 PISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSIT 582

Query: 194 VTHEMGFAREVADRVVFMDG 213
           ++H+  F   V + ++  +G
Sbjct: 583 ISHDSVFLDNVCEYIINYEG 602


>2iw3B [x.x.x] ELONGATION FACTOR 3A
          Length = 958

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ ++ +A      P +++ DEPT+ LD + +G +   +++   G   ++++TH  
Sbjct: 879 LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSA 935

Query: 199 GFAREVADRVVFMDGGQ 215
            F + + + V  +  G+
Sbjct: 936 EFTKNLTEEVWAVKDGR 952



 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 28/200 (14%)

Query: 14  FGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRA 73
           +G   +L    L +    +  I GP+G GKSTL    N       G+V  DG   +++  
Sbjct: 435 YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIAN-------GQV--DGFPTQEECR 485

Query: 74  LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR 133
              V  ++             +VL+ V  + +  +                  G  D+  
Sbjct: 486 TVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEIA 531

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
              A LSGG + ++A+ARA+     I+L DEPT+ LD   V  +++ +      G+T + 
Sbjct: 532 PISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSIT 586

Query: 194 VTHEMGFAREVADRVVFMDG 213
           ++H+  F   V + ++  +G
Sbjct: 587 ISHDSVFLDNVCEYIINYEG 606


>2iw3A [x.x.x] ELONGATION FACTOR 3A
          Length = 950

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 139 LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEM 198
           LSGGQ+ ++ +A      P +++ DEPT+ LD + +G +   +++   G   ++++TH  
Sbjct: 875 LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSA 931

Query: 199 GFAREVADRVVFMDGGQ 215
            F + + + V  +  G+
Sbjct: 932 EFTKNLTEEVWAVKDGR 948



 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 28/200 (14%)

Query: 14  FGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRA 73
           +G   +L    L +    +  I GP+G GKSTL    N       G+V  DG   +++  
Sbjct: 431 YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIAN-------GQV--DGFPTQEECR 481

Query: 74  LREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQAR 133
              V  ++             +VL+ V  + +  +                  G  D+  
Sbjct: 482 TVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEIA 527

Query: 134 KYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVV 193
              A LSGG + ++A+ARA+     I+L DEPT+ LD   V  +++ +      G+T + 
Sbjct: 528 PISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSIT 582

Query: 194 VTHEMGFAREVADRVVFMDG 213
           ++H+  F   V + ++  +G
Sbjct: 583 ISHDSVFLDNVCEYIINYEG 602


>2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 215

 Score = 42.7 bits (99), Expect = 1e-06
 Identities = 46/204 (22%), Positives = 81/204 (39%), Gaps = 24/204 (11%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G   VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G         
Sbjct: 18  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI------- 70

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARK 134
                       QF+     T+ EN+         +                 I   A K
Sbjct: 71  --------SFCSQFSWIMPGTIKENIIFGVS----YDEYRYRSVIKACQLEEDISKFAEK 118

Query: 135 ----YPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMT 190
                   LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T
Sbjct: 119 DNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT 178

Query: 191 MVVVTHEMGFAREVADRVVFMDGG 214
            ++VT +M   ++ AD+++ +  G
Sbjct: 179 RILVTSKMEHLKK-ADKILILHEG 201


>1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 246

 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 43/198 (21%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 15  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 63

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQA--RKYP 136
                   QF+     T+ EN+        R+              +    D     +  
Sbjct: 64  ----SFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG 119

Query: 137 AQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTH 196
             LS GQQ ++++ARA+  +  + L D P   LD     E+ +          T ++VT 
Sbjct: 120 ITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 179

Query: 197 EMGFAREVADRVVFMDGG 214
           +M   ++ AD+++ +  G
Sbjct: 180 KMEHLKK-ADKILILHEG 196


>2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 223

 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 45/203 (22%), Positives = 82/203 (40%), Gaps = 19/203 (9%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G   VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G         
Sbjct: 15  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI------- 67

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA- 132
                       QF+     T+ EN+         R+              +    D   
Sbjct: 68  --------SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV 119

Query: 133 -RKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +    LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T 
Sbjct: 120 LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR 179

Query: 192 VVVTHEMGFAREVADRVVFMDGG 214
           ++VT +M   ++ AD+++ +  G
Sbjct: 180 ILVTSKMEHLKK-ADKILILHEG 201


>2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 219

 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 45/203 (22%), Positives = 82/203 (40%), Gaps = 19/203 (9%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G   VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G         
Sbjct: 16  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI------- 68

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA- 132
                       QF+     T+ EN+         R+              +    D   
Sbjct: 69  --------SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV 120

Query: 133 -RKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +    LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T 
Sbjct: 121 LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR 180

Query: 192 VVVTHEMGFAREVADRVVFMDGG 214
           ++VT +M   ++ AD+++ +  G
Sbjct: 181 ILVTSKMEHLKK-ADKILILHEG 202


>2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 226

 Score = 41.6 bits (96), Expect = 2e-06
 Identities = 45/203 (22%), Positives = 82/203 (40%), Gaps = 19/203 (9%)

Query: 15  GPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRAL 74
           G   VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G         
Sbjct: 19  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI------- 71

Query: 75  REVRREVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA- 132
                       QF+     T+ EN+         R+              +    D   
Sbjct: 72  --------SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV 123

Query: 133 -RKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTM 191
             +    LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T 
Sbjct: 124 LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR 183

Query: 192 VVVTHEMGFAREVADRVVFMDGG 214
           ++VT +M   ++ AD+++ +  G
Sbjct: 184 ILVTSKMEHLKK-ADKILILHEG 205


>1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 40.8 bits (94), Expect = 4e-06
 Identities = 44/199 (22%), Positives = 81/199 (40%), Gaps = 19/199 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 35  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 83

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--RKY 135
                   QF+     T+ EN+         R+              +    D     + 
Sbjct: 84  ----SFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 139

Query: 136 PAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
              LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT
Sbjct: 140 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 199

Query: 196 HEMGFAREVADRVVFMDGG 214
            +M   ++ AD+++ +  G
Sbjct: 200 SKMEHLKK-ADKILILHEG 217


>1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 270

 Score = 40.8 bits (94), Expect = 4e-06
 Identities = 44/199 (22%), Positives = 81/199 (40%), Gaps = 19/199 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 39  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 87

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--RKY 135
                   QF+     T+ EN+         R+              +    D     + 
Sbjct: 88  ----SFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 143

Query: 136 PAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
              LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT
Sbjct: 144 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 203

Query: 196 HEMGFAREVADRVVFMDGG 214
            +M   ++ AD+++ +  G
Sbjct: 204 SKMEHLKK-ADKILILHEG 221


>1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 40.8 bits (94), Expect = 4e-06
 Identities = 44/199 (22%), Positives = 81/199 (40%), Gaps = 19/199 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 36  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 84

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--RKY 135
                   QF+     T+ EN+         R+              +    D     + 
Sbjct: 85  ----SFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 140

Query: 136 PAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
              LSGGQ+ R+++ARA+  +  + L D P   LD     E+ +          T ++VT
Sbjct: 141 GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 200

Query: 196 HEMGFAREVADRVVFMDGG 214
            +M   ++ AD+++ +  G
Sbjct: 201 SKMEHLKK-ADKILILHEG 218


>2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 254

 Score = 38.5 bits (88), Expect = 2e-05
 Identities = 43/199 (21%), Positives = 80/199 (40%), Gaps = 19/199 (9%)

Query: 19  VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKDDRALREVR 78
           VLK I+ ++  G+ L + G +G+GK++L+  I    +  EG++   G             
Sbjct: 21  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----------- 69

Query: 79  REVGMVFQQFNLFPHMTVLENVTLAPMRVR-RWPRXXXXXXXXXXXXRVGILDQA--RKY 135
                   QF+     T+ EN+         R+              +    D     + 
Sbjct: 70  ----SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG 125

Query: 136 PAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVT 195
              LS GQQ ++++ARA+  +  + L D P   LD     E+ +          T ++VT
Sbjct: 126 GITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVT 185

Query: 196 HEMGFAREVADRVVFMDGG 214
            +M   ++ AD+++ +  G
Sbjct: 186 SKMEHLKK-ADKILILHEG 203


>2zyoA [x.x.x] SOLUTE-BINDING PROTEIN
          Length = 385

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 11/68 (16%)

Query: 5  IRIRNLHKWFGPLHVLKGIHLEVAP------GEKLVIIGPSGSGKSTLIRTINRLEDFQE 58
          +++ N  KW G      GI +EV P       EKL + GP+G G   +    +RL     
Sbjct: 19 VQLNNTKKWAGEFTKKTGIQVEVVPVALLKQQEKLTLDGPAGKGADLVTWPHDRL----- 73

Query: 59 GEVVVDGL 66
          GE V  GL
Sbjct: 74 GEAVTKGL 81


>2zynA [x.x.x] SOLUTE-BINDING PROTEIN
          Length = 383

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 11/68 (16%)

Query: 5  IRIRNLHKWFGPLHVLKGIHLEVAP------GEKLVIIGPSGSGKSTLIRTINRLEDFQE 58
          +++ N  KW G      GI +EV P       EKL + GP+G G   +    +RL     
Sbjct: 17 VQLNNTKKWAGEFTKKTGIQVEVVPVALLKQQEKLTLDGPAGKGADLVTWPHDRL----- 71

Query: 59 GEVVVDGL 66
          GE V  GL
Sbjct: 72 GEAVTKGL 79


>2zymA [x.x.x] SOLUTE-BINDING PROTEIN
          Length = 381

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 11/68 (16%)

Query: 5  IRIRNLHKWFGPLHVLKGIHLEVAP------GEKLVIIGPSGSGKSTLIRTINRLEDFQE 58
          +++ N  KW G      GI +EV P       EKL + GP+G G   +    +RL     
Sbjct: 15 VQLNNTKKWAGEFTKKTGIQVEVVPVALLKQQEKLTLDGPAGKGADLVTWPHDRL----- 69

Query: 59 GEVVVDGL 66
          GE V  GL
Sbjct: 70 GEAVTKGL 77


>1ii8B [c.37.1] RAD50 ABC-ATPASE
          Length = 174

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 139 LSGGQQQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
           LSGG++  + +A  LAM      E  +++ DEPT  LD E   +++ +M    +    ++
Sbjct: 84  LSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVI 143

Query: 193 VVTHEMGFAREVADRVV 209
           +V+H+    ++ AD V+
Sbjct: 144 LVSHDEEL-KDAADHVI 159


>1f2uD [c.37.1] RAD50 ABC-ATPASE
          Length = 142

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 139 LSGGQQQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
           LSGG++  + +A  LAM      E  +++ DEPT  LD E   +++ +M    +    ++
Sbjct: 52  LSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVI 111

Query: 193 VVTHEMGFAREVADRVV 209
           +V+H+    ++ AD V+
Sbjct: 112 LVSHDEEL-KDAADHVI 127


>1f2uB [c.37.1] RAD50 ABC-ATPASE
          Length = 145

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 139 LSGGQQQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
           LSGG++  + +A  LAM      E  +++ DEPT  LD E   +++ +M    +    ++
Sbjct: 55  LSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVI 114

Query: 193 VVTHEMGFAREVADRVV 209
           +V+H+    ++ AD V+
Sbjct: 115 LVSHDEEL-KDAADHVI 130


>1f2tB [c.37.1] RAD50 ABC-ATPASE
          Length = 143

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 139 LSGGQQQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMV 192
           LSGG++  + +A  LAM      E  +++ DEPT  LD E   +++ +M    +    ++
Sbjct: 53  LSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVI 112

Query: 193 VVTHEMGFAREVADRVV 209
           +V+H+    ++ AD V+
Sbjct: 113 LVSHDEEL-KDAADHVI 128


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.322    0.140    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 832,759,003
Number of extensions: 33176681
Number of successful extensions: 84284
Number of sequences better than 1.0e-03: 1745
Number of HSP's gapped: 82093
Number of HSP's successfully gapped: 2375
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)