BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS81529.1 tthe0 AAS81529.1 GIB00176CH01 "GMP synthase"
         (503 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2ywbC [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    741   0.0  
2ywbA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    737   0.0  
2ywbB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    735   0.0  
2ywbD [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    733   0.0  
2ywcD [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    723   0.0  
2ywcB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    720   0.0  
2ywcA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    720   0.0  
1gpmA [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE                      379   e-108
1gpmB [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE                      374   e-106
2vxoB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    214   6e-58
2vxoA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]                    193   1e-51
3a4iA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B          191   5e-51
2z0cA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B          190   7e-51
2dplA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B          189   2e-50
2dplB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B          187   6e-50
2z0cB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B          182   2e-48
1wl8A [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A          127   5e-32
2d7jA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A          125   3e-31
2vpiA [x.x.x] GMP SYNTHASE                                            104   6e-25
2vpiB [x.x.x] GMP SYNTHASE                                            102   2e-24
2a9vD [x.x.x] GMP SYNTHASE                                             82   4e-18
2a9vC [x.x.x] GMP SYNTHASE                                             82   4e-18
2a9vB [x.x.x] GMP SYNTHASE                                             82   4e-18
2a9vA [x.x.x] GMP SYNTHASE                                             81   6e-18
1i7qB [c.23.16] TRPG                                                   61   8e-12
1i1qB [c.23.16] ANTHRANILATE SYNTHASE COMPONENT II                     57   9e-11
1qdlB [c.23.16] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))         57   2e-10
1t36B [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE SMALL CHAIN       44   1e-06
1jdbF [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE                 43   2e-06
1bxrB [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE                   43   2e-06
1m6vB [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHETASE SMALL CHAIN     41   9e-06
1c30B [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL SU...    39   3e-05
1ox6A [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF    35   4e-04
1ox4A [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF    35   4e-04
1cs0B [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL SU...    35   6e-04

>2ywbC [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 466

 Score =  741 bits (1913), Expect = 0.0
 Identities = 465/503 (92%), Positives = 465/503 (92%), Gaps = 37/503 (7%)

Query: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60
           MVLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA
Sbjct: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60

Query: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV 120
           PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA    YGKALLTRHEGPLFRGLEGEV
Sbjct: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA----YGKALLTRHEGPLFRGLEGEV 116

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
           QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF
Sbjct: 117 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 176

Query: 181 LELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 240
           LELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF
Sbjct: 177 LELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 236

Query: 241 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 300
           VDH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS
Sbjct: 237 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 296

Query: 301 QVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKD 360
           QVARERGPFRFLAQGTLYPDVIESA                                 KD
Sbjct: 297 QVARERGPFRFLAQGTLYPDVIESA---------------------XXXXXXXXXXXXKD 335

Query: 361 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 420
           EVRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
Sbjct: 336 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 395

Query: 421 KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 480
           KVAQALAVLTPV            GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
Sbjct: 396 KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 443

Query: 481 RVPEIGRVVYDLTSKPPATIEWE 503
           RVPEIGRVVYDLTSKPPATIEWE
Sbjct: 444 RVPEIGRVVYDLTSKPPATIEWE 466


>2ywbA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 471

 Score =  737 bits (1903), Expect = 0.0
 Identities = 468/503 (93%), Positives = 468/503 (93%), Gaps = 32/503 (6%)

Query: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60
           MVLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA
Sbjct: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60

Query: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV 120
           PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA   EYGKALLTRHEGPLFRGLEGEV
Sbjct: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA---EYGKALLTRHEGPLFRGLEGEV 117

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
           QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF
Sbjct: 118 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 177

Query: 181 LELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 240
           LELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF
Sbjct: 178 LELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 237

Query: 241 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 300
           VDH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS
Sbjct: 238 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 297

Query: 301 QVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKD 360
           QVARERGPFRFLAQGTLYPDVI                                    KD
Sbjct: 298 QVARERGPFRFLAQGTLYPDVI-----------------XXXXXXXXXXXXXXXXXXXKD 340

Query: 361 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 420
           EVRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
Sbjct: 341 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 400

Query: 421 KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 480
           KVAQALAVLTPV            GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
Sbjct: 401 KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 448

Query: 481 RVPEIGRVVYDLTSKPPATIEWE 503
           RVPEIGRVVYDLTSKPPATIEWE
Sbjct: 449 RVPEIGRVVYDLTSKPPATIEWE 471


>2ywbB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 463

 Score =  735 bits (1897), Expect = 0.0
 Identities = 462/503 (91%), Positives = 462/503 (91%), Gaps = 40/503 (7%)

Query: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60
           MVLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA
Sbjct: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60

Query: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV 120
           PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA    YGKALLTRHEGPLFRGLEGEV
Sbjct: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA----YGKALLTRHEGPLFRGLEGEV 116

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
           QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF
Sbjct: 117 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 176

Query: 181 LELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 240
           LELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF
Sbjct: 177 LELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 236

Query: 241 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 300
           VDH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS
Sbjct: 237 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 296

Query: 301 QVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKD 360
           QVARERGPFRFLAQGTLYPDVI                                    KD
Sbjct: 297 QVARERGPFRFLAQGTLYPDVI------------------------XXXXXXXXXXXXKD 332

Query: 361 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 420
           EVRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
Sbjct: 333 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 392

Query: 421 KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 480
           KVAQALAVLTPV            GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
Sbjct: 393 KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 440

Query: 481 RVPEIGRVVYDLTSKPPATIEWE 503
           RVPEIGRVVYDLTSKPPATIEWE
Sbjct: 441 RVPEIGRVVYDLTSKPPATIEWE 463


>2ywbD [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 463

 Score =  733 bits (1892), Expect = 0.0
 Identities = 462/503 (91%), Positives = 462/503 (91%), Gaps = 40/503 (7%)

Query: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60
           MVLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA
Sbjct: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60

Query: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV 120
           PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVER     YGKALLTRHEGPLFRGLEGEV
Sbjct: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVER-----YGKALLTRHEGPLFRGLEGEV 115

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
           QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF
Sbjct: 116 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 175

Query: 181 LELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 240
           LELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF
Sbjct: 176 LELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF 235

Query: 241 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 300
           VDH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS
Sbjct: 236 VDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS 295

Query: 301 QVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKD 360
           QVARERGPFRFLAQGTLYPDVI                                    KD
Sbjct: 296 QVARERGPFRFLAQGTLYPDVI-----------------------XXXXXXXXXXXXXKD 332

Query: 361 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 420
           EVRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
Sbjct: 333 EVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE 392

Query: 421 KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 480
           KVAQALAVLTPV            GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
Sbjct: 393 KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR 440

Query: 481 RVPEIGRVVYDLTSKPPATIEWE 503
           RVPEIGRVVYDLTSKPPATIEWE
Sbjct: 441 RVPEIGRVVYDLTSKPPATIEWE 463


>2ywcD [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 462

 Score =  723 bits (1865), Expect = 0.0
 Identities = 450/502 (89%), Positives = 450/502 (89%), Gaps = 40/502 (7%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           VLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP
Sbjct: 1   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 60

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 121
           RPDPRLFSSGLPLLGICYG QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ
Sbjct: 61  RPDPRLFSSGLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 119

Query: 122 VWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL 181
           VW SHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG QILENFL
Sbjct: 120 VW-SHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFL 177

Query: 182 ELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV 241
           ELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV
Sbjct: 178 ELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV 237

Query: 242 DHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ 301
           DH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ
Sbjct: 238 DHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ 297

Query: 302 VARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDE 361
           VARERGPFRFLAQGTLYPDVI                                    KDE
Sbjct: 298 VARERGPFRFLAQGTLYPDVI-------------------------FELLEPFRLLFKDE 332

Query: 362 VREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK 421
           VRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK
Sbjct: 333 VREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK 392

Query: 422 VAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRR 481
           VAQALAVLTPVR           GYVLALRAVTTEDF TADWARLPLEFLDEAARRITRR
Sbjct: 393 VAQALAVLTPVR-----------GYVLALRAVTTEDF-TADWARLPLEFLDEAARRITRR 440

Query: 482 VPEIGRVVYDLTSKPPATIEWE 503
           VPEIGRVVYDLTSKPPATIEWE
Sbjct: 441 VPEIGRVVYDLTSKPPATIEWE 462


>2ywcB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 462

 Score =  720 bits (1859), Expect = 0.0
 Identities = 461/502 (91%), Positives = 461/502 (91%), Gaps = 40/502 (7%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           VLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP
Sbjct: 1   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 60

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 121
           RPDPRLFSSGLPLLGICYG QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ
Sbjct: 61  RPDPRLFSSGLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 119

Query: 122 VWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL 181
           VW SHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG QILENFL
Sbjct: 120 VW-SHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFL 177

Query: 182 ELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV 241
           ELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV
Sbjct: 178 ELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV 237

Query: 242 DHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ 301
           DH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ
Sbjct: 238 DHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ 297

Query: 302 VARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDE 361
           VARERGPFRFLAQGTLYPDVI                                    KDE
Sbjct: 298 VARERGPFRFLAQGTLYPDVI------------------------XXXXXXXXXXXXKDE 333

Query: 362 VREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK 421
           VRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK
Sbjct: 334 VREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK 393

Query: 422 VAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRR 481
           VAQALAVLTPV            GYVLALRAVTTEDF TADWARLPLEFLDEAARRITRR
Sbjct: 394 VAQALAVLTPV------------GYVLALRAVTTEDF-TADWARLPLEFLDEAARRITRR 440

Query: 482 VPEIGRVVYDLTSKPPATIEWE 503
           VPEIGRVVYDLTSKPPATIEWE
Sbjct: 441 VPEIGRVVYDLTSKPPATIEWE 462


>2ywcA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 470

 Score =  720 bits (1859), Expect = 0.0
 Identities = 466/502 (92%), Positives = 466/502 (92%), Gaps = 32/502 (6%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           VLVLDFGSQYT            FSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP
Sbjct: 1   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 60

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 121
           RPDPRLFSSGLPLLGICYG QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ
Sbjct: 61  RPDPRLFSSGLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 119

Query: 122 VWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL 181
           VW SHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG QILENFL
Sbjct: 120 VW-SHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFL 177

Query: 182 ELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV 241
           ELAG KRDWTPEH            AGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV
Sbjct: 178 ELAGVKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV 237

Query: 242 DHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ 301
           DH                  GVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ
Sbjct: 238 DHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQ 297

Query: 302 VARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDE 361
           VARERGPFRFLAQGTLYPDVI                                    KDE
Sbjct: 298 VARERGPFRFLAQGTLYPDVI----------------XXXXXXXXXXXXXXXXXXXXKDE 341

Query: 362 VREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK 421
           VRE             RHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK
Sbjct: 342 VREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEK 401

Query: 422 VAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRR 481
           VAQALAVLTPV            GYVLALRAVTTEDF TADWARLPLEFLDEAARRITRR
Sbjct: 402 VAQALAVLTPV------------GYVLALRAVTTEDF-TADWARLPLEFLDEAARRITRR 448

Query: 482 VPEIGRVVYDLTSKPPATIEWE 503
           VPEIGRVVYDLTSKPPATIEWE
Sbjct: 449 VPEIGRVVYDLTSKPPATIEWE 470


>1gpmA [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
          Length = 501

 Score =  379 bits (974), Expect = e-108
 Identities = 222/514 (43%), Positives = 289/514 (56%), Gaps = 32/514 (6%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           +L+LDFGSQYT            +  +   D    ++    P  +ILSGGP S  + ++P
Sbjct: 8   ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSP 67

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALL-TRHEGPLFRGLEGEV 120
           R    +F +G+P+ G+CYGMQ +A +LGG VE +   E+G A +   ++  L RG+E  +
Sbjct: 68  RAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGIEDAL 127

Query: 121 --------QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPK 172
                    VWMSH D VTA P  +  VA TE  P A +A+ + R YGVQFHPEV HT +
Sbjct: 128 TADGKPLLDVWMSHGDKVTAIPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQ 187

Query: 173 GMQILENFL-ELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAK 231
           GM++LE F+ ++   +  WTP               G D+V+L +SGGVDSS  A+LL +
Sbjct: 188 GMRMLERFVRDICQCEALWTPAKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLHR 247

Query: 232 A-GVDHLAVFVDHXXXXXXXXXXXXXXXXXX-GVNLLVVDAKERFLKALKGVEDPEEKRK 289
           A G +   VFVD+                   G+N++ V A++RFL AL G  DPE KRK
Sbjct: 248 AIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGENDPEAKRK 307

Query: 290 IIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXX 349
           IIGR FV  F + A +    ++LAQGT+YPDVIESA   G  +                 
Sbjct: 308 IIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAAKMGLVE----------------- 350

Query: 350 XXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIF 409
                    KDEVR+             RHPFPGPGL VRVLGEV +E  ++LRRAD IF
Sbjct: 351 ---PLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF 407

Query: 410 TSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLE 469
              LR+  LY+KV+QA  V  PVRSVGV GD RKY +V++LRAV T DFMTA WA LP +
Sbjct: 408 IEELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYD 467

Query: 470 FLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
           FL   + RI   V  I RVVYD++ KPPATIEWE
Sbjct: 468 FLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 501


>1gpmB [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
          Length = 499

 Score =  374 bits (960), Expect = e-106
 Identities = 220/514 (42%), Positives = 286/514 (55%), Gaps = 34/514 (6%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           +L+LDFGSQYT            +  +   D    ++    P  +ILSGGP S  + ++P
Sbjct: 8   ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSP 67

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALL-TRHEGPLFRGLEGEV 120
           R    +F +G+P+ G+CYGMQ +A +LGG VE +   E+G A +   ++  L RG+E  +
Sbjct: 68  RAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGIEDAL 127

Query: 121 --------QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPK 172
                    VWMSH D VTA P  +  VA TE  P A +A+ + R YGVQFHPEV HT +
Sbjct: 128 TADGKPLLDVWMSHGDKVTAIPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQ 187

Query: 173 GMQILENFL-ELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAK 231
           GM++LE F+ ++   +  WTP               G D+V+L +SGGVDSS  A+LL +
Sbjct: 188 GMRMLERFVRDICQCEALWTPAKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLHR 247

Query: 232 A-GVDHLAVFVDH-XXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKGVEDPEEKRK 289
           A G +   VFVD+                   G+N++ V A++RFL AL G  DPE KRK
Sbjct: 248 AIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGENDPEAKRK 307

Query: 290 IIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXX 349
           IIGR FV  F + A +    ++LAQGT+YPDVIE   G                      
Sbjct: 308 IIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIEMKMG---------------------- 345

Query: 350 XXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIF 409
                    KDEVR+             RHPFPGPGL VRVLGEV +E  ++LRRAD IF
Sbjct: 346 LVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIF 405

Query: 410 TSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLE 469
              LR+  LY+KV+QA  V  PVRSVGV GD RKY +V++LRAV T DFMTA WA LP +
Sbjct: 406 IEELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYD 465

Query: 470 FLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
           FL   + RI   V  I RVVYD++ KPPATIEWE
Sbjct: 466 FLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 499


>2vxoB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 658

 Score =  214 bits (544), Expect = 6e-58
 Identities = 176/535 (32%), Positives = 245/535 (45%), Gaps = 59/535 (11%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           V++LD G+QY              S I P + P   + +   +A+I+SGGP SV+  DAP
Sbjct: 6   VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAP 65

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQ 121
             DP +F+ G P+LGICYGMQ++ +  GG V +     +   +   +   LFRGL+ E  
Sbjct: 66  WFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSDGVFN--ISVDNTCSLFRGLQKEEV 123

Query: 122 VWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL 181
           V ++H D+V     G++VVA +  N VA IA+   + YG QFHPEV  T  G  IL+NFL
Sbjct: 124 VLLTHGDSVDKVADGFKVVARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFL 182

Query: 182 -ELAGAKRDWTPEHXXXXXXXXXXXXAGKDRVLLAVSGGVDSSTLALLLAKA--GVDHLA 238
            ++AG    +T ++             G  +VL+ +SGGVDS+    LL +A      +A
Sbjct: 183 YDIAGCSGTFTVQNRELECIREIKERVGTSKVLVLLSGGVDSTVCTALLNRALNQEQVIA 242

Query: 239 VFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFL----------KALKGVEDPEEKR 288
           V +D+                  G+ + V++A   F           K L     PEEKR
Sbjct: 243 VHIDNGFMRKRESQSVEEALKKLGIQVKVINAAHSFYNGTTTLPRISKTLNMTTSPEEKR 302

Query: 289 KIIGREFVAAFSQVARE---RGPFRFLAQGTLYPDVIESAGGHGAAK---IKSHHNVGG- 341
           KIIG  FV   ++V  E   +    FLAQGTL PD+IESA    + K   IK+HHN    
Sbjct: 303 KIIGDTFVKIANEVIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTEL 362

Query: 342 -XXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRV-------LGE 393
                             KDEVR              RHPFPGPGLA+RV       + +
Sbjct: 363 IRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICK 422

Query: 394 VTEERLEILRRADDIFTSLLREWGLYEKVAQAL------------------AVLTPVRSV 435
              E   IL+   D   S+ +   L ++V                      A L P+++V
Sbjct: 423 DFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTV 482

Query: 436 GVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY 490
           GV GD R Y YV     ++++D    DW     E L   AR I R    + RVVY
Sbjct: 483 GVQGDCRSYSYVC---GISSKD--EPDW-----ESLIFLARLIPRMCHNVNRVVY 527



 Score = 58.5 bits (140), Expect = 4e-11
 Identities = 39/110 (35%), Positives = 58/110 (52%), Gaps = 6/110 (5%)

Query: 399 LEILRRADDIFTSLLREWGLYEKVAQALAVLTPVR-SVGVAGDERKYGYVLALRAVTTED 457
           L  LR+AD    ++LRE G   K++Q   +LTP+         +      + +R   T D
Sbjct: 550 LSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSD 609

Query: 458 FMTADWA----RLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
           FMT   A     +P+E + +    I +++P I R++YDLTSKPP T EWE
Sbjct: 610 FMTGIPATPGNEIPVEVVLKMVTEI-KKIPGISRIMYDLTSKPPGTTEWE 658


>2vxoA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
          Length = 643

 Score =  193 bits (490), Expect = 1e-51
 Identities = 167/511 (32%), Positives = 229/511 (44%), Gaps = 70/511 (13%)

Query: 26  SLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSSGLPLLGICYGMQLLA 85
           S I P + P   + +   +A+I+SGGP       AP  DP +F+ G P+LGICYGMQ++ 
Sbjct: 26  SEIFPLETPAFAIKEQGFRAIIISGGP-------APWFDPAIFTIGKPVLGICYGMQMMN 78

Query: 86  QELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVVAETEE 145
           +  GG V +                 LFRGL+ E  V ++H D+V     G++VVA +  
Sbjct: 79  KVFGGTVHKVFNISVDNTC------SLFRGLQKEEVVLLTHGDSVDKVADGFKVVARS-G 131

Query: 146 NPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFL-ELAGAKRDWTPEHXXXXXXXXXX 204
           N VA IA+   + YG QFHPEV  T  G  IL+NFL ++AG    +T ++          
Sbjct: 132 NIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIK 191

Query: 205 XXAGKDRVLLAVSGGVDSSTLALLLAKA--GVDHLAVFVDHXXXXXXXXXXXXXXXXXXG 262
              G  +VL+ +SGGVDS+    LL +A      +AV +D+                  G
Sbjct: 192 ERVGTSKVLVLLSGGVDSTVCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLG 251

Query: 263 VNLLVVDAKERFL----------KALKGVEDPEEKRKIIGREFVAAFSQVARE---RGPF 309
           + + V++A   F           K L     PEEKRKIIG  FV   ++V  E   +   
Sbjct: 252 IQVKVINAAHSFYNGTTTLPRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMNLKPEE 311

Query: 310 RFLAQGTLYPDVIESAGGHGAAK---IKSHHNVGG--XXXXXXXXXXXXXXXXXKDEVRE 364
            FLAQGTL PD+IESA    + K   IK+HHN                      KDEVR 
Sbjct: 312 VFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVRI 371

Query: 365 XXXXXXXXXXXXXRHPFPGPGLAVRV-------LGEVTEERLEILRRADDIFTSLLREWG 417
                        RHPFPGPGLA+RV       + +   E   IL+   D   S+ +   
Sbjct: 372 LGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHT 431

Query: 418 LYEKVAQAL------------------AVLTPVRSVGVAGDERKYGYVLALRAVTTEDFM 459
           L ++V                      A L P+++VGV GD R Y YV     ++++D  
Sbjct: 432 LLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVC---GISSKD-- 486

Query: 460 TADWARLPLEFLDEAARRITRRVPEIGRVVY 490
             DW     E L   AR I R    + RVVY
Sbjct: 487 EPDW-----ESLIFLARLIPRMCHNVNRVVY 512



 Score = 58.5 bits (140), Expect = 4e-11
 Identities = 39/110 (35%), Positives = 58/110 (52%), Gaps = 6/110 (5%)

Query: 399 LEILRRADDIFTSLLREWGLYEKVAQALAVLTPVR-SVGVAGDERKYGYVLALRAVTTED 457
           L  LR+AD    ++LRE G   K++Q   +LTP+         +      + +R   T D
Sbjct: 535 LSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSD 594

Query: 458 FMTADWA----RLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
           FMT   A     +P+E + +    I +++P I R++YDLTSKPP T EWE
Sbjct: 595 FMTGIPATPGNEIPVEVVLKMVTEI-KKIPGISRIMYDLTSKPPGTTEWE 643


>3a4iA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
          Length = 286

 Score =  191 bits (484), Expect = 5e-51
 Identities = 126/298 (42%), Positives = 163/298 (54%), Gaps = 32/298 (10%)

Query: 208 GKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDHXXXXXXXXXXXXXXXXXX-GVNL 265
           G  + ++A+SGGVDSST A+L  KA  D L AVFV+                    G+NL
Sbjct: 19  GDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNL 78

Query: 266 LVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESA 325
             VDA++RF  ALKGV DPEEKRKIIGR F+  F +VA++ G   +L QGT+ P++    
Sbjct: 79  HYVDAQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTIAPNL---- 133

Query: 326 GGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPG 385
                                            KDEVRE             R PFPGPG
Sbjct: 134 -----------------------KLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPG 170

Query: 386 LAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYG 445
           LAVRV+GEVT E++ I+R A+ I    +   GL  +  QA AVL  V++VGV GD R Y 
Sbjct: 171 LAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--RPWQAFAVLLGVKTVGVQGDIRAYK 228

Query: 446 YVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
             +A+R V + D MTA+   +P E L   A RIT  +PE+GRV+YD+T+KPPATIE+E
Sbjct: 229 ETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLYDITNKPPATIEFE 286


>2z0cA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
          Length = 284

 Score =  190 bits (483), Expect = 7e-51
 Identities = 127/298 (42%), Positives = 163/298 (54%), Gaps = 34/298 (11%)

Query: 208 GKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDHXXXXXXXXXXXXXXXXXX-GVNL 265
           G  + ++A+SGGVDSST A+L  KA  D L AVFV+                    G+NL
Sbjct: 19  GDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNL 78

Query: 266 LVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESA 325
             VDA++RF  ALKGV DPEEKRKIIGR F+  F +VA++ G   +L QGT+   +IE  
Sbjct: 79  HYVDAQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTIALKLIEPL 137

Query: 326 GGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPG 385
                                            KDEVRE             R PFPGPG
Sbjct: 138 -----------------------------RDLYKDEVRELAKFLGLPEKIYNRMPFPGPG 168

Query: 386 LAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYG 445
           LAVRV+GEVT E++ I+R A+ I    +   GL  +  QA AVL  V++VGV GD R Y 
Sbjct: 169 LAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--RPWQAFAVLLGVKTVGVQGDIRAYK 226

Query: 446 YVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
             +A+R V + D MTA+   +P E L   A RIT  +PE+GRV+YD+T+KPPATIE+E
Sbjct: 227 ETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLYDITNKPPATIEFE 284


>2dplA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
          Length = 287

 Score =  189 bits (480), Expect = 2e-50
 Identities = 126/298 (42%), Positives = 163/298 (54%), Gaps = 31/298 (10%)

Query: 208 GKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDHXXXXXXXXXXXXXXXXXX-GVNL 265
           G  + ++A+SGGVDSST A+L  KA  D L AVFV+                    G+NL
Sbjct: 19  GDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNL 78

Query: 266 LVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESA 325
             VDA++RF  ALKGV DPEEKRKIIGR F+  F +VA++ G   +L QGT+ P  ++  
Sbjct: 79  HYVDAQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTIAPLNLK-- 135

Query: 326 GGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPG 385
                                            KDEVRE             R PFPGPG
Sbjct: 136 ------------------------LIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPG 171

Query: 386 LAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYG 445
           LAVRV+GEVT E++ I+R A+ I    +   GL  +  QA AVL  V++VGV GD R Y 
Sbjct: 172 LAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--RPWQAFAVLLGVKTVGVQGDIRAYK 229

Query: 446 YVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
             +A+R V + D MTA+   +P E L   A RIT  +PE+GRV+YD+T+KPPATIE+E
Sbjct: 230 ETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLYDITNKPPATIEFE 287


>2dplB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
          Length = 278

 Score =  187 bits (475), Expect = 6e-50
 Identities = 127/298 (42%), Positives = 163/298 (54%), Gaps = 35/298 (11%)

Query: 208 GKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDHXXXXXXXXXXXXXXXXXX-GVNL 265
           G  + ++A+SGGVDSST A+L  KA  D L AVFV+                    G+NL
Sbjct: 14  GDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNL 73

Query: 266 LVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESA 325
             VDA++RF  ALKGV DPEEKRKIIGR F+  F +VA++ G   +L QGT+   +IE  
Sbjct: 74  HYVDAQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTILK-LIEPL 131

Query: 326 GGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPG 385
                                            KDEVRE             R PFPGPG
Sbjct: 132 -----------------------------RDLYKDEVRELAKFLGLPEKIYNRMPFPGPG 162

Query: 386 LAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYG 445
           LAVRV+GEVT E++ I+R A+ I    +   GL  +  QA AVL  V++VGV GD R Y 
Sbjct: 163 LAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--RPWQAFAVLLGVKTVGVQGDIRAYK 220

Query: 446 YVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
             +A+R V + D MTA+   +P E L   A RIT  +PE+GRV+YD+T+KPPATIE+E
Sbjct: 221 ETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLYDITNKPPATIEFE 278


>2z0cB [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
          Length = 278

 Score =  182 bits (461), Expect = 2e-48
 Identities = 126/298 (42%), Positives = 162/298 (54%), Gaps = 38/298 (12%)

Query: 208 GKDRVLLAVSGGVDSSTLALLLAKAGVDHL-AVFVDHXXXXXXXXXXXXXXXXXX-GVNL 265
           G  + ++A+SGGVDSST A+L  KA  D L AVFV+                    G+NL
Sbjct: 17  GDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNL 76

Query: 266 LVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESA 325
             VDA++RF  ALKGV DPEEKRKIIGR F+  F +VA++ G   +L QGT+   +IE  
Sbjct: 77  HYVDAQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTILK-LIEPL 134

Query: 326 GGHGAAKIKSHHNVGGXXXXXXXXXXXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPG 385
                                            KDEVRE             R PFPGPG
Sbjct: 135 -----------------------------RDLYKDEVRELAKFLGLPEKIYNRMPFPGPG 165

Query: 386 LAVRVLGEVTEERLEILRRADDIFTSLLREWGLYEKVAQALAVLTPVRSVGVAGDERKYG 445
           LAVRV+GEVT E++ I+R A+ I    +   GL  +  QA AVL  V++VGV GD R Y 
Sbjct: 166 LAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--RPWQAFAVLLGVKTVGVQGDIRAYK 223

Query: 446 YVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVYDLTSKPPATIEWE 503
             +A+R V +   MTA+   +P E L   A RIT  +PE+GRV+YD+T+KPPATIE+E
Sbjct: 224 ETIAVRIVES---MTANAMNVPWEVLQRIAFRITSEIPEVGRVLYDITNKPPATIEFE 278


>1wl8A [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
          Length = 186

 Score =  127 bits (320), Expect = 5e-32
 Identities = 68/185 (36%), Positives = 101/185 (54%), Gaps = 1/185 (0%)

Query: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60
           M++++D G QY              + I+P   PLEE+    P+ +I SGGP      + 
Sbjct: 2   MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNC 61

Query: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV 120
            +         +P+LGIC G QL+A+  GG+V R  +AEY    +   +  +F+GL   +
Sbjct: 62  EKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEEIFKGLPKRL 121

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
           +VW SH D V   PP ++++A + E P+ A+   +   YGVQFHPEVAHT KG +IL NF
Sbjct: 122 KVWESHMDEVKELPPKFKILARS-ETPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNF 180

Query: 181 LELAG 185
            +L G
Sbjct: 181 AKLCG 185


>2d7jA [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
          Length = 188

 Score =  125 bits (314), Expect = 3e-31
 Identities = 68/186 (36%), Positives = 98/186 (52%), Gaps = 1/186 (0%)

Query: 1   MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA 60
           M++++D G QY              + I+P   PLEE+    P+ +I SGGP      + 
Sbjct: 1   MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNC 60

Query: 61  PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPL-FRGLEGE 119
            +         +P+LGIC G QL+A+  GG+V R  +AEY             F+GL   
Sbjct: 61  EKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVXXXXXXXXXXFKGLPKR 120

Query: 120 VQVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILEN 179
           ++VW SH D V   PP ++++A +E  P+ A+   +   YGVQFHPEVAHT KG +IL N
Sbjct: 121 LKVWESHMDEVKELPPKFKILARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRN 180

Query: 180 FLELAG 185
           F +L G
Sbjct: 181 FAKLCG 186


>2vpiA [x.x.x] GMP SYNTHASE
          Length = 187

 Score =  104 bits (259), Expect = 6e-25
 Identities = 71/192 (36%), Positives = 102/192 (53%), Gaps = 12/192 (6%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           V++LD G+QY              S I P + P   + +   +A+I+SG         AP
Sbjct: 5   VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG---------AP 55

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGK-ALLTRHEGPLFRGLEGEV 120
             DP +F+ G P+LGICYGMQ++ +  GG V +    E G   +   +   LFRGL+ E 
Sbjct: 56  WFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEE 115

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
            V ++H D+V     G++VVA +  N VA IA+   + YG QFHPEV  T  G  IL+NF
Sbjct: 116 VVLLTHGDSVDKVADGFKVVARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNF 174

Query: 181 L-ELAGAKRDWT 191
           L ++AG    +T
Sbjct: 175 LYDIAGCSGTFT 186


>2vpiB [x.x.x] GMP SYNTHASE
          Length = 186

 Score =  102 bits (254), Expect = 2e-24
 Identities = 70/192 (36%), Positives = 101/192 (52%), Gaps = 13/192 (6%)

Query: 2   VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAP 61
           V++LD G+QY              S I P + P   + +   +A+I+SG          P
Sbjct: 5   VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG----------P 54

Query: 62  RPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGK-ALLTRHEGPLFRGLEGEV 120
             DP +F+ G P+LGICYGMQ++ +  GG V +    E G   +   +   LFRGL+ E 
Sbjct: 55  WFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEE 114

Query: 121 QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF 180
            V ++H D+V     G++VVA +  N VA IA+   + YG QFHPEV  T  G  IL+NF
Sbjct: 115 VVLLTHGDSVDKVADGFKVVARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNF 173

Query: 181 L-ELAGAKRDWT 191
           L ++AG    +T
Sbjct: 174 LYDIAGCSGTFT 185


>2a9vD [x.x.x] GMP SYNTHASE
          Length = 199

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 41/122 (33%), Positives = 59/122 (48%)

Query: 73  PLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTA 132
           P+LGIC G Q +A   G  V +A   E+GK  ++ H   +F GL  E+ VW +H D +  
Sbjct: 77  PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIIN 136

Query: 133 PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTP 192
            P  + + A +    V          Y  QFHPEV HT  G  I  NF+ +  + R+   
Sbjct: 137 LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQK 196

Query: 193 EH 194
           E+
Sbjct: 197 EN 198


>2a9vC [x.x.x] GMP SYNTHASE
          Length = 197

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 41/122 (33%), Positives = 59/122 (48%)

Query: 73  PLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTA 132
           P+LGIC G Q +A   G  V +A   E+GK  ++ H   +F GL  E+ VW +H D +  
Sbjct: 75  PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIIN 134

Query: 133 PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTP 192
            P  + + A +    V          Y  QFHPEV HT  G  I  NF+ +  + R+   
Sbjct: 135 LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQK 194

Query: 193 EH 194
           E+
Sbjct: 195 EN 196


>2a9vB [x.x.x] GMP SYNTHASE
          Length = 195

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 41/122 (33%), Positives = 59/122 (48%)

Query: 73  PLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTA 132
           P+LGIC G Q +A   G  V +A   E+GK  ++ H   +F GL  E+ VW +H D +  
Sbjct: 74  PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIIN 133

Query: 133 PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTP 192
            P  + + A +    V          Y  QFHPEV HT  G  I  NF+ +  + R+   
Sbjct: 134 LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQK 193

Query: 193 EH 194
           E+
Sbjct: 194 EN 195


>2a9vA [x.x.x] GMP SYNTHASE
          Length = 197

 Score = 81.3 bits (199), Expect = 6e-18
 Identities = 40/117 (34%), Positives = 57/117 (48%)

Query: 73  PLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTA 132
           P+LGIC G Q +A   G  V +A   E+GK  ++ H   +F GL  E+ VW +H D +  
Sbjct: 77  PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIIN 136

Query: 133 PPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRD 189
            P  + + A +    V          Y  QFHPEV HT  G  I  NF+ +  + R+
Sbjct: 137 LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYRE 193


>1i7qB [c.23.16] TRPG
          Length = 192

 Score = 60.8 bits (146), Expect = 8e-12
 Identities = 50/153 (32%), Positives = 69/153 (45%), Gaps = 3/153 (1%)

Query: 37  EVLKHRPQ-ALILSGGPRSVFDPDAPRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERA 95
           E L+H  Q  L+LS GP +  +        +     LP++GIC G Q + +  GG+V +A
Sbjct: 41  ERLQHMEQPVLMLSPGPGTPSEAGCMPELLQRLRGQLPIIGICLGHQAIVEAYGGQVGQA 100

Query: 96  GRAEYGKALLTRHEGP-LFRGLEGEVQVWMSHQDAVTAPPPGWRVVAETEENPVAAIASP 154
           G   +GKA    H+G  +F G+   + V   H    +  P    V A   E  V A    
Sbjct: 101 GEILHGKASAIAHDGEGMFAGMANPLPVARYHSLVGSNIPADLTVNARFGE-MVMAXXXX 159

Query: 155 DGRAYGVQFHPEVAHTPKGMQILENFLELAGAK 187
                G QFHPE   T  G ++LE  L  A AK
Sbjct: 160 XXXXCGFQFHPESILTTHGARLLEQTLAWALAK 192


>1i1qB [c.23.16] ANTHRANILATE SYNTHASE COMPONENT II
          Length = 186

 Score = 57.4 bits (137), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 71/163 (43%), Gaps = 14/163 (8%)

Query: 29  LPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFS---SGLPLLGICYGMQLLA 85
           +P    ++ +   +   L+LS GP     P      P L +     LP++GIC G Q + 
Sbjct: 34  IPAQTLIDRLATMKNPVLMLSPGPGV---PSEAGCMPELLTRLRGKLPIIGICLGHQAIV 90

Query: 86  QELGGRVERAGRAEYGKALLTRHEGP-LFRGLEGEVQVWMSHQDAVTAPPPGWRVVAETE 144
           +  GG V   G+  +GKA    H+G  +F GL   + V   H   V   P G  + A   
Sbjct: 91  EAYGGYV---GQILHGKATSIEHDGQAMFAGLANPLPVARYHSSNV---PAGLTINAHFN 144

Query: 145 ENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAK 187
              V A+     R  G QFHPE   T +G ++LE  L  A  K
Sbjct: 145 -GMVMAVRHDADRVCGFQFHPESILTTQGARLLEQTLAWAQQK 186


>1qdlB [c.23.16] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
          Length = 195

 Score = 56.6 bits (135), Expect = 2e-10
 Identities = 45/147 (30%), Positives = 63/147 (42%), Gaps = 8/147 (5%)

Query: 43  PQALILSGGPRSVF---DPDAPRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAE 99
           P  LI+S GP +     D        +      P+LG+C G Q +    G ++ RA +  
Sbjct: 46  PDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVF 105

Query: 100 YGKA----LLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVVA-ETEENPVAAIASP 154
           +GK     L+      L+ G+  E +    H   V        V A   E+N + AI   
Sbjct: 106 HGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHE 165

Query: 155 DGRAYGVQFHPEVAHTPKGMQILENFL 181
           +   YGVQFHPE   T  G +IL NFL
Sbjct: 166 EYPIYGVQFHPESVGTSLGYKILYNFL 192


>1t36B [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE SMALL CHAIN
          Length = 379

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 46/165 (27%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 28  ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQ 86
           I+P     E+VLK  P  + LS GP      D A     +   + +P+ GIC G QLLA 
Sbjct: 217 IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPDDYAITAIQKFLETDIPVFGICLGHQLLAL 276

Query: 87  ELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVV 140
             G +     + ++G      H G      + E  V M    +H  AV     P   RV 
Sbjct: 277 ASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT 327

Query: 141 AET-EENPVAAIASPDGRAYGVQFHPEVAHTP-KGMQILENFLEL 183
            ++  +  +  I   D  A+  Q HPE +  P     + ++F+EL
Sbjct: 328 HKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIEL 372


>1jdbF [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE
          Length = 380

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 46/165 (27%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 28  ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQ 86
           I+P     E+VLK  P  + LS GP      D A     +   + +P+ GIC G QLLA 
Sbjct: 217 IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLAL 276

Query: 87  ELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVV 140
             G +     + ++G      H G      + E  V M    +H  AV     P   RV 
Sbjct: 277 ASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT 327

Query: 141 AET-EENPVAAIASPDGRAYGVQFHPEVAHTP-KGMQILENFLEL 183
            ++  +  +  I   D  A+  Q HPE +  P     + ++F+EL
Sbjct: 328 HKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIEL 372


>1bxrB [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
          Length = 379

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 46/165 (27%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 28  ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQ 86
           I+P     E+VLK  P  + LS GP      D A     +   + +P+ GIC G QLLA 
Sbjct: 217 IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLAL 276

Query: 87  ELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVV 140
             G +     + ++G      H G      + E  V M    +H  AV     P   RV 
Sbjct: 277 ASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT 327

Query: 141 AET-EENPVAAIASPDGRAYGVQFHPEVAHTP-KGMQILENFLEL 183
            ++  +  +  I   D  A+  Q HPE +  P     + ++F+EL
Sbjct: 328 HKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIEL 372


>1m6vB [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHETASE SMALL CHAIN
          Length = 375

 Score = 40.8 bits (94), Expect = 9e-06
 Identities = 45/164 (27%), Positives = 68/164 (41%), Gaps = 20/164 (12%)

Query: 28  ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQ 86
           I+P     E+VLK  P  + LS GP      D A     +   + +P+ GIC G QLLA 
Sbjct: 217 IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLAL 276

Query: 87  ELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVV 140
             G +     + ++G      H G      + E  V M    +H  AV     P   RV 
Sbjct: 277 ASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT 327

Query: 141 AET-EENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLEL 183
            ++  +  +  I   D  A+  Q HPE +       + ++F+EL
Sbjct: 328 HKSLFDGTLQGIHRTDKPAFSFQGHPEAS---PAAPLFDHFIEL 368


>1c30B [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
           SUBUNIT
          Length = 379

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 45/165 (27%), Positives = 68/165 (41%), Gaps = 18/165 (10%)

Query: 28  ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQ 86
           I+P     E+VLK  P  + LS GP      D A     +   + +P+ GI  G QLLA 
Sbjct: 217 IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGISLGHQLLAL 276

Query: 87  ELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVV 140
             G +     + ++G      H G      + E  V M    +H  AV     P   RV 
Sbjct: 277 ASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT 327

Query: 141 AET-EENPVAAIASPDGRAYGVQFHPEVAHTP-KGMQILENFLEL 183
            ++  +  +  I   D  A+  Q HPE +  P     + ++F+EL
Sbjct: 328 HKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIEL 372


>1ox6A [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
          Length = 531

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 36/156 (23%), Positives = 59/156 (37%), Gaps = 31/156 (19%)

Query: 54  SVFDPDAPRPDPRLFSSGLPLLGICYGMQLLAQELGGRVE--RAGRAEYGKALLTRHEGP 111
           ++F+    +P      SG P++GIC G+Q L     G VE  ++    Y    L+R +  
Sbjct: 62  NLFNRGFEKPIREYIESGKPIMGICVGLQAL---FAGSVESPKSTGLNYIDFKLSRFDDS 118

Query: 112 -----------------LFRGLEGEVQVWMSHQDAV--------TAPPPGWRVVAETEEN 146
                            LF GL+   + +  H  A              GW++      +
Sbjct: 119 EKPVPEIGWNSCIPSENLFFGLDPYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGS 178

Query: 147 PVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLE 182
                A      +  QFHPE +    G+ ++ENFL+
Sbjct: 179 EEFIAAVNKNNIFATQFHPEKS-GKAGLNVIENFLK 213


>1ox4A [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
          Length = 534

 Score = 35.4 bits (80), Expect = 4e-04
 Identities = 36/156 (23%), Positives = 59/156 (37%), Gaps = 31/156 (19%)

Query: 54  SVFDPDAPRPDPRLFSSGLPLLGICYGMQLLAQELGGRVE--RAGRAEYGKALLTRHEGP 111
           ++F+    +P      SG P++GIC G+Q L     G VE  ++    Y    L+R +  
Sbjct: 62  NLFNRGFEKPIREYIESGKPIMGICVGLQAL---FAGSVESPKSTGLNYIDFKLSRFDDS 118

Query: 112 -----------------LFRGLEGEVQVWMSHQDAV--------TAPPPGWRVVAETEEN 146
                            LF GL+   + +  H  A              GW++      +
Sbjct: 119 EKPVPEIGWNSCIPSENLFFGLDPYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGS 178

Query: 147 PVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLE 182
                A      +  QFHPE +    G+ ++ENFL+
Sbjct: 179 EEFIAAVNKNNIFATQFHPEKS-GKAGLNVIENFLK 213


>1cs0B [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
           SUBUNIT
          Length = 378

 Score = 34.7 bits (78), Expect = 6e-04
 Identities = 45/165 (27%), Positives = 68/165 (41%), Gaps = 19/165 (11%)

Query: 28  ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQ 86
           I+P     E+VLK  P  + LS GP      D A     +   + +P+ GI  G QLLA 
Sbjct: 217 IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGI-LGHQLLAL 275

Query: 87  ELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVV 140
             G +     + ++G      H G      + E  V M    +H  AV     P   RV 
Sbjct: 276 ASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT 326

Query: 141 AET-EENPVAAIASPDGRAYGVQFHPEVAHTP-KGMQILENFLEL 183
            ++  +  +  I   D  A+  Q HPE +  P     + ++F+EL
Sbjct: 327 HKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIEL 371


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.135    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 832,475,757
Number of extensions: 33310273
Number of successful extensions: 88155
Number of sequences better than 1.0e-03: 1996
Number of HSP's gapped: 85799
Number of HSP's successfully gapped: 2277
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)