BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS81982.1 tthe0 AAS81982.1 GIB00176CH01 "folylpolyglutamate
synthase"
         (414 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1o5zA [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE     209   2e-56
1jbwA [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE                   152   2e-39
1w7kA [x.x.x] FOLC BIFUNCTIONAL PROTEIN                               146   9e-38
1w78A [x.x.x] FOLC BIFUNCTIONAL PROTEIN                               143   8e-37
2gcaA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE                             142   2e-36
1jbvA [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE                   141   4e-36
2gcbA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE                             137   4e-35
2gc5A [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE                             135   2e-34
2gc6A [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE                             134   4e-34
1fgsA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHETASE                           122   2e-30
2vorA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC                 84   7e-19
2vosA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC                 77   7e-17

>1o5zA [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE
          Length = 421

 Score =  209 bits (531), Expect = 2e-56
 Identities = 155/430 (36%), Positives = 219/430 (50%), Gaps = 32/430 (7%)

Query: 1   MDPLSWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEA 60
           ++ L +LY +     PGLERI  LL++LG+P   Y    +GGTNGKG+ A  ++ IL   
Sbjct: 7   LEVLRYLYHK---VKPGLERISMLLSKLGNPHLEYKTIHIGGTNGKGSVANMVSNILVSQ 63

Query: 61  GFRVGLYTSPHLVDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXX------SFFEAAT 114
           G+RVG Y SPHL  FRERI++    I                           SFFE  T
Sbjct: 64  GYRVGSYYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVT 123

Query: 115 ALALLHFAREGVEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREK 174
           A+A L+FA + V+ AVLEVGLGGRLDATN   P+ S +  V          T++ +A EK
Sbjct: 124 AMAFLYFAEKNVDIAVLEVGLGGRLDATNVVFPLCSTIVTVDR-------YTIEQIAWEK 176

Query: 175 AGIFRGGVPALTA-AQGEGLGVLRAEALARKTPLWVLGEDFHAEGVEALPEGLAFTLRLE 233
           +GI +  VP +T   + E L V+   A  + + ++V+ +DF  +          F    E
Sbjct: 177 SGIIKERVPLVTGERKREALKVMEDVARKKSSRMYVIDKDFSVKVKSLKLHENRFDYCGE 236

Query: 234 RTGEALRLTARLLGPHQAENXXXXXXXXXXXXXXW--EAVKRGVARAENPGRLQRLLWRG 291
            T E L LT  + GPHQ EN                 +A++ G+  A+N GR + L   G
Sbjct: 237 NTFEDLVLT--MNGPHQIENAGVALKTLEATGLPLSEKAIREGLKNAKNLGRFEILEKNG 294

Query: 292 RELLLDGAHNPEGALALREALR--FHGLLPAAFVLGFSRDKDHAAMAEALRGL-GPVVLT 348
           +  +LDGAHNP GA +L  +L+  F+G  P + V+G   DK+   +     G+   V++T
Sbjct: 295 KMYILDGAHNPHGAESLVRSLKLYFNG-EPLSLVIGILDDKNREDILRKYTGIFERVIVT 353

Query: 349 RYASLRSEDPRALLPL----FPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRL 404
           R  S R +D  +L+ +    F   +V+EDPLEA+E   S E   VV GSL+LVG V   L
Sbjct: 354 RVPSPRMKDMNSLVDMAKKFFKNVEVIEDPLEAIE---STERATVVTGSLFLVGYVREFL 410

Query: 405 EGLPAEERWQ 414
                 E W+
Sbjct: 411 TTGKINEEWK 420


>1jbwA [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE
          Length = 409

 Score =  152 bits (383), Expect = 2e-39
 Identities = 125/403 (31%), Positives = 184/403 (45%), Gaps = 33/403 (8%)

Query: 20  RIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDFRERI 79
           RI  LL  LG+P++      V GTNGKG+ A  +A +LE +G  VGLYTSP ++ F ERI
Sbjct: 24  RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERI 83

Query: 80  QVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREGVEFAVLE 132
            +   PI                              FE  TALA  +F +  V+ AV+E
Sbjct: 84  MIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALAYWYFRQRQVDVAVIE 143

Query: 133 VGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEG 192
           VG+GG  D+TN   PV+SV+T V  DH ++LG T+  +A+  AGI + G+P +T      
Sbjct: 144 VGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPD 202

Query: 193 LGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQA 251
                          W+    DF     +    G  FT   ++ G    L   L+G +Q 
Sbjct: 203 XXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQ 261

Query: 252 ENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDGAHNPEGA 305
            N               E       +++G+A +  P RL+++      +++DGAHNP+G 
Sbjct: 262 RNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKIS-DTPLIVIDGAHNPDGI 320

Query: 306 LALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDPRALLPLF 365
             L  AL+     P   + G   DKD+AAMA+ L      V              L+P+ 
Sbjct: 321 NGLITALKQLFSQPITVIAGILADKDYAAMADRLTAAFSTVY-------------LVPV- 366

Query: 366 PGAKVVEDPLEALEEAFS--REGRVVVAGSLYLVGEVLRRLEG 406
           PG ++ +   EAL  + +   +  +V+ GSLYL   V + L G
Sbjct: 367 PGTRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG 409


>1w7kA [x.x.x] FOLC BIFUNCTIONAL PROTEIN
          Length = 410

 Score =  146 bits (369), Expect = 9e-38
 Identities = 115/349 (32%), Positives = 164/349 (46%), Gaps = 31/349 (8%)

Query: 5   SWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRV 64
           SWL   +     GLER+  + ARLG  + A  V  V GTNGKGTT RTL +IL  AG++V
Sbjct: 10  SWLSYLENLIDLGLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKV 69

Query: 65  GLYTSPHLVDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSFFEAATALALLHFARE 124
           G+Y+SPHLV + ER++VQG+ +                     ++FE  T  AL  F + 
Sbjct: 70  GVYSSPHLVRYTERVRVQGQELPESAHTASFAEIESARGDISLTYFEYGTLSALWLFKQA 129

Query: 125 GVEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPA 184
            ++  +LEVGLGGRLDATN  +  ++VVT++  DH + LGP  + + RE AGIFR   PA
Sbjct: 130 QLDVVILEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRESIGRE-AGIFRSEKPA 188

Query: 185 LTA-----AQGEGLGVLRAEALARKTPLW---VLGEDFHAEGVEALPEGLAFTLRLERTG 236
           +       +    +   +   L R+   W   V   D+         E L   L  +   
Sbjct: 189 IVGEPEMPSTIADVAQEKGALLQRRGVEWNYSVTDHDWAFSDAHGTLENLPLPLVPQPNX 248

Query: 237 EALRLTARLLGPHQAENXXXXXXXXXXXXXXWEAVKRGVARAENPGRLQRLLWRGRELLL 296
                     G   +EN                A++ G+A A  PGR Q ++     ++ 
Sbjct: 249 XXXXXXXXXSGLEVSEN----------------AIRDGIASAILPGRFQ-IVSESPRVIF 291

Query: 297 DGAHNPEGALAL---REALRFHGLLPAAFVLGFSRDKDHAAMAEALRGL 342
           D AHNP  A  L    +AL  +G + A  V+G   DKD A     L+ +
Sbjct: 292 DVAHNPHAAEYLTGRMKALPKNGRVLA--VIGMLHDKDIAGTLAWLKSV 338


>1w78A [x.x.x] FOLC BIFUNCTIONAL PROTEIN
          Length = 413

 Score =  143 bits (361), Expect = 8e-37
 Identities = 112/337 (33%), Positives = 160/337 (47%), Gaps = 31/337 (9%)

Query: 17  GLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDFR 76
           GLER+  + ARLG  + A  V  V GTNGKGTT RTL +IL  AG++VG+Y+SPHLV + 
Sbjct: 26  GLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSPHLVRYT 85

Query: 77  ERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSFFEAATALALLHFAREGVEFAVLEVGLG 136
           ER++VQG+ +                     ++FE  T  AL  F +  ++  +LEVGLG
Sbjct: 86  ERVRVQGQELPESAHTASFAEIESARGDISLTYFEYGTLSALWLFKQAQLDVVILEVGLG 145

Query: 137 GRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTA-----AQGE 191
           GRLDATN  +  ++VVT++  DH + LGP  + + RE AGIFR   PA+       +   
Sbjct: 146 GRLDATNIVDADVAVVTSIALDHTDWLGPDRESIGRE-AGIFRSEKPAIVGEPEMPSTIA 204

Query: 192 GLGVLRAEALARKTPLW---VLGEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGP 248
            +   +   L R+   W   V   D+         E L   L  +             G 
Sbjct: 205 DVAQEKGALLQRRGVEWNYSVTDHDWAFSDAHGTLENLPLPLVPQPNXXXXXXXXXXSGL 264

Query: 249 HQAENXXXXXXXXXXXXXXWEAVKRGVARAENPGRLQRLLWRGRELLLDGAHNPEGALAL 308
             +EN                A++ G+A A  PGR Q ++     ++ D AHNP  A  L
Sbjct: 265 EVSEN----------------AIRDGIASAILPGRFQ-IVSESPRVIFDVAHNPHAAEYL 307

Query: 309 ---REALRFHGLLPAAFVLGFSRDKDHAAMAEALRGL 342
               +AL  +G + A  V+G   DKD A     L+ +
Sbjct: 308 TGRMKALPKNGRVLA--VIGMLHDKDIAGTLAWLKSV 342


>2gcaA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
          Length = 410

 Score =  142 bits (358), Expect = 2e-36
 Identities = 123/403 (30%), Positives = 180/403 (44%), Gaps = 32/403 (7%)

Query: 20  RIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDFRERI 79
           RI  LL  LG+P++      V GTNGKG+ A  +A +LE +G  VGLYTSP ++ F ERI
Sbjct: 24  RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERI 83

Query: 80  QVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREGVEFAVLE 132
            +   PI                              FE  TAL   +F +  V+ AV+E
Sbjct: 84  MIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALGYWYFRQRQVDVAVIE 143

Query: 133 VGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEG 192
           VG+GG  D+TN   PV+SV+T V  DH ++LG T+  +A+ KAGI + G+P +T      
Sbjct: 144 VGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPD 203

Query: 193 LGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQA 251
                          W+    DF     +    G  FT   ++ G    L   L+G +Q 
Sbjct: 204 XXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQ 262

Query: 252 ENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDGAHNPEGA 305
            N               E       +++G+A +  P RL+++      +++DGAHNP+G 
Sbjct: 263 RNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKIS-DTPLIVIDGAHNPDGI 321

Query: 306 LALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDPRALLPLF 365
             L  AL+     P   + G      +AAMA+ L        T Y       PRAL    
Sbjct: 322 NGLITALKQLFSQPITVIAGIL----YAAMADRLTA---AFSTVYLVPVPGTPRAL---- 370

Query: 366 PGAKVVEDPLEALEEAFS--REGRVVVAGSLYLVGEVLRRLEG 406
              ++ +   EAL  + +   +  +V+ GSLYL   V + L G
Sbjct: 371 ---RLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG 410


>1jbvA [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE
          Length = 403

 Score =  141 bits (355), Expect = 4e-36
 Identities = 125/403 (31%), Positives = 182/403 (45%), Gaps = 34/403 (8%)

Query: 20  RIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDFRERI 79
           RI  LL  LG+P++      V GTNGKG+ A  +A +LE +G  VGLYTSP ++ F ERI
Sbjct: 19  RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERI 78

Query: 80  QVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREGVEFAVLE 132
            +   PI                              FE  TALA  +F +  V+ AV+E
Sbjct: 79  MIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALAYWYFRQRQVDVAVIE 138

Query: 133 VGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEG 192
           VG+GG  D+TN   PV+SV+T V  DH ++LG T+  +A+  AGI + G+P +T      
Sbjct: 139 VGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPD 197

Query: 193 LGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQA 251
                          W+    DF     +    G  FT   ++ G    L   L+G +Q 
Sbjct: 198 XXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQ 256

Query: 252 ENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDGAHNPEGA 305
            N               E       +++G+A +  P RL+++      +++DGAHNP+G 
Sbjct: 257 RNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKIS-DTPLIVIDGAHNPDGI 315

Query: 306 LALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDPRALLPLF 365
             L  AL+     P   + G   D+  AA +     L PV  T         PRAL    
Sbjct: 316 NGLITALKQLFSQPITVIAGAMADRLTAAFSTVY--LVPVPGT---------PRAL---- 360

Query: 366 PGAKVVEDPLEALEEAFS--REGRVVVAGSLYLVGEVLRRLEG 406
           P A++ +   EAL  + +   +  +V+ GSLYL   V + L G
Sbjct: 361 PEARLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG 403


>2gcbA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
          Length = 407

 Score =  137 bits (346), Expect = 4e-35
 Identities = 122/403 (30%), Positives = 178/403 (44%), Gaps = 35/403 (8%)

Query: 20  RIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDFRERI 79
           RI  LL  LG+P++      V GTNGK T A  +A +LE +G  VGLYTSP ++ F ERI
Sbjct: 24  RILTLLHALGNPQQQGRYIHVTGTNGKSTAANAIAHVLEASGLTVGLYTSPFIMRFNERI 83

Query: 80  QVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREGVEFAVLE 132
            +   PI                              FE  TAL   +F +  V+ AV+E
Sbjct: 84  MIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALGYWYFRQRQVDVAVIE 143

Query: 133 VGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEG 192
           VG+GG  D+TN   PV+SV+T+V  DH ++LG T+  +A+ KAGI + G+P +T      
Sbjct: 144 VGIGGDTDSTNVITPVVSVLTSVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPD 203

Query: 193 LGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQA 251
                          W+    DF     +    G  FT   ++ G    L   L+G +Q 
Sbjct: 204 XXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQ 262

Query: 252 ENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDGAHNPEGA 305
            N               E       +++G+A +  P RL+++      +++DGAHNP+G 
Sbjct: 263 RNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKIS-DTPLIVIDGAHNPDGI 321

Query: 306 LALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDPRALLPLF 365
             L  AL+     P   + G     D    A +   L PV  T         PRAL    
Sbjct: 322 NGLITALKQLFSQPITVIAGILM-ADRLTAAFSTVYLVPVPGT---------PRAL---- 367

Query: 366 PGAKVVEDPLEALEEAFS--REGRVVVAGSLYLVGEVLRRLEG 406
              ++ +   EAL  + +   +  +V+ GSLYL   V + L G
Sbjct: 368 ---RLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG 407


>2gc5A [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
          Length = 407

 Score =  135 bits (340), Expect = 2e-34
 Identities = 123/410 (30%), Positives = 180/410 (43%), Gaps = 33/410 (8%)

Query: 13  RFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHL 72
           R A    RI  LL  LG+P++      V GTNGK + A  +A +LE +G  VGLYTSP +
Sbjct: 15  RLAKDHRRILTLLHALGNPQQQGRYIHVTGTNGKSSAANAIAHVLEASGLTVGLYTSPFI 74

Query: 73  VDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREG 125
           + F ERI +   PI                              FE  TAL   +F +  
Sbjct: 75  MRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALGYWYFRQRQ 134

Query: 126 VEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPAL 185
           V+ AV+EVG+GG  D+TN   PV+SV+T V  DH ++LG T+  +A+  AGI + G+P +
Sbjct: 135 VDVAVIEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVV 193

Query: 186 TAAQGEGLGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTAR 244
           T                     W+    DF     +    G  FT   ++ G    L   
Sbjct: 194 TGNLVPDXXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVP 252

Query: 245 LLGPHQAENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDG 298
           L+G +Q  N               E       +++G+A +  P RL+++      +++DG
Sbjct: 253 LVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKIS-DTPLIVIDG 311

Query: 299 AHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDP 358
           AHNP+G   L  AL+     P   + G      +AAMA+ L        T Y       P
Sbjct: 312 AHNPDGINGLITALKQLFSQPITVIAGI-----YAAMADRLTA---AFSTVYLVPVPGTP 363

Query: 359 RALLPLFPGAKVVEDPLEALEEAFS--REGRVVVAGSLYLVGEVLRRLEG 406
           RAL       ++ +   EAL  + +   +  +V+ GSLYL   V + L G
Sbjct: 364 RAL------PRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG 407


>2gc6A [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
          Length = 406

 Score =  134 bits (338), Expect = 4e-34
 Identities = 121/403 (30%), Positives = 179/403 (44%), Gaps = 33/403 (8%)

Query: 20  RIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDFRERI 79
           RI  LL  LG+P++      V GTNGKG+ A  +A +LE +G  VGLYT+P ++ F ERI
Sbjct: 21  RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTAPFIMRFNERI 80

Query: 80  QVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREGVEFAVLE 132
            +   PI                              FE  TAL   +F +  V+ AV+E
Sbjct: 81  MIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALGYWYFRQRQVDVAVIE 140

Query: 133 VGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEG 192
           VG+GG  D+TN   PV+SV+T V  DH ++LG T+  +A+  AGI + G+P +T      
Sbjct: 141 VGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPD 199

Query: 193 LGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQA 251
                          W+    DF     +    G  FT   ++ G    L   L+G +Q 
Sbjct: 200 XXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQ 258

Query: 252 ENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDGAHNPEGA 305
            N               E       +++G+A +  P RL+++      +++DGAHNP+G 
Sbjct: 259 RNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKIS-DTPLIVIDGAHNPDGI 317

Query: 306 LALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDPRALLPLF 365
             L  AL+     P   + G      +AAMA+ L        T Y       PRAL    
Sbjct: 318 NGLITALKQLFSQPITVIAGIL----YAAMADRLTA---AFSTVYLVPVPGTPRAL---- 366

Query: 366 PGAKVVEDPLEALEEAFS--REGRVVVAGSLYLVGEVLRRLEG 406
              ++ +   EAL  + +   +  +V+ GSLYL   V + L G
Sbjct: 367 ---RLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG 406


>1fgsA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHETASE
          Length = 393

 Score =  122 bits (306), Expect = 2e-30
 Identities = 118/408 (28%), Positives = 171/408 (41%), Gaps = 43/408 (10%)

Query: 13  RFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHL 72
           R A    RI  LL  LG+P++      V GTNGKG+ A  +A +LE +G  VGLYTSP +
Sbjct: 15  RLAGDHRRILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFI 74

Query: 73  VDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSF-------FEAATALALLHFAREG 125
           + F ERI +   PI                              FE  TALA  +F +  
Sbjct: 75  MRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADFNVTEFEFITALAYWYFRQRQ 134

Query: 126 VEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPAL 185
           V+ AV+EVG     D+TN   PV+SV+T V  D       T+  +A+ KAGI + G+P +
Sbjct: 135 VDVAVIEVG-----DSTNVITPVVSVLTEVALD-------TITAIAKHKAGIIKRGIPVV 182

Query: 186 TAAQGEGLGVLRAEALARKTPLWV-LGEDFHAEGVEALPEGLAFTLRLERTGEALRLTAR 244
           T                     W+    DF     +    G  FT   ++ G    L   
Sbjct: 183 TGNLVPDXXXXXXXXXXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVP 241

Query: 245 LLGPHQAENXXXXXXXXXXXXXXWE------AVKRGVARAENPGRLQRLLWRGRELLLDG 298
           L+G +Q  N               E       +++G+A +  P RL+++      +++DG
Sbjct: 242 LVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPL-IVIDG 300

Query: 299 AHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDP 358
           AHNP+G   L  AL+     P   + G++   D    A +   L PV  T    L+    
Sbjct: 301 AHNPDGINGLITALKQLFSQPITVIAGYAAMADRLTAAFSTVYLVPVPGTPRGRLKDSWQ 360

Query: 359 RALLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRLEG 406
            AL      A + + P          +  +V+ GSLYL   V + L G
Sbjct: 361 EAL-----AASLNDVP----------DQPIVITGSLYLASAVRQTLLG 393


>2vorA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
          Length = 442

 Score = 84.0 bits (206), Expect = 7e-19
 Identities = 101/375 (26%), Positives = 136/375 (36%), Gaps = 42/375 (11%)

Query: 16  PGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSPHLVDF 75
           P L RI AL+  LG P+ +YP   + GTNGK + AR + A++     R G  TSPHL   
Sbjct: 17  PSLTRISALMDLLGSPQRSYPSIHIAGTNGKTSVARMVDALVTALHRRTGRTTSPHLQSP 76

Query: 76  RERIQVQGRPI--------XXXXXXXXXXXXXXXXXXXXXSFFEAATALALLHFAREGVE 127
            ERI + G+PI                             S FE  T             
Sbjct: 77  VERISIDGKPISPAQYVATYREIEPLVALIDQQSQASPAMSKFEVLTXXXXXXXXXXXXX 136

Query: 128 FAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIF-RGGVPALT 186
                    GR DATN     ++V+T +  DH++ L                R   P   
Sbjct: 137 XXXXXXXXXGRWDATNVINAPVAVITPISIDHVDYLXXXXXXXXXXXXXXXTRAPSPDTV 196

Query: 187 AAQGEGLGVLRAEALARKTPLWVLGEDFHAEGVEALPEGLAFTLRLERTGEALR------ 240
           A  G  +          K    +L E   A+   A  +     LR +             
Sbjct: 197 AVIGRQV---------PKVMEVLLAESVRADASVAREDSEFAVLRRQIAXXXXXXXXXXX 247

Query: 241 ------LTARLLGPHQAEN---XXXXXXXXXXXXXXWEAVKRGVARAENPGRLQRLLWRG 291
                 +   L G HQA N                  +AV+ G A   +PGRL+R+    
Sbjct: 248 XXXYSDIYLPLHGEHQAHNAVLALASVEAFFGAQLDGDAVRAGFAAVTSPGRLERMR-SA 306

Query: 292 RELLLDGAHNPEGALALREALR----FHGLLPAAFVLGFSRDKDHAAMAEALRGL-GPVV 346
             + +D AHNP GA AL + L     F  L+    VLG   DKD   +  AL  +   VV
Sbjct: 307 PTVFIDAAHNPAGASALAQTLAHEFDFRFLVGVLSVLG---DKDVDGILAALEPVFDSVV 363

Query: 347 LTRYASLRSEDPRAL 361
           +T   S R+ D  AL
Sbjct: 364 VTHNGSPRALDVEAL 378


>2vosA [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
          Length = 441

 Score = 77.4 bits (189), Expect = 7e-17
 Identities = 109/383 (28%), Positives = 143/383 (37%), Gaps = 47/383 (12%)

Query: 7   LYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGL 66
           L  ++ R  P L RI AL   LG P+ +YP   + GTNGK + AR + A++     R G 
Sbjct: 12  LLDQRWRIDPSLTRISAL-DLLGSPQRSYPSIHIAGTNGKTSVAR-VDALVTALHRRTGR 69

Query: 67  YTSPHLVDFRERIQVQGRPI-------XXXXXXXXXXXXXXXXXXXXXSFFEAATALALL 119
            TSPHL    ERI + G+PI                            S FE  T     
Sbjct: 70  TTSPHLQSPVERISIDGKPISPAQYVATYREIEPLVALIDQQSQASPASKFEVLT-XXXX 128

Query: 120 HFAREGVEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIF- 178
                       EVG GGR DATN     ++V+T +  DH++ L                
Sbjct: 129 XXXXXXXXXXXXEVG-GGRWDATNVINAPVAVITPISIDHVDYLXXXXXXXXXXXXXXXT 187

Query: 179 RGGVPALTAAQGEGLGVLRAEALARKTPLWVLGEDFHAEGVEALPEGLAFTLRLERTGEA 238
           R   P   A  G    V + E L        L E   A+   A  +     LR +     
Sbjct: 188 RAPSPDTVAVIGR--QVPKVEVL--------LAESVRADASVAREDSEFAVLRRQIAXXX 237

Query: 239 LR------------LTARLLGPHQAEN---XXXXXXXXXXXXXXWEAVKRGVARAENPGR 283
                         +   L G HQA N                  +AV+ G A   +PGR
Sbjct: 238 XXXXXXXXXXXYSDIYLPLHGEHQAHNAVLALASVEAFFGAQLDGDAVRAGFAAVTSPGR 297

Query: 284 LQRLLWRGRELLLDGAHNPEGALALREALR----FHGLLPAAFVLGFSRDKDHAAMAEAL 339
           L+R       + +D AHNP GA AL + L     F  L+    VLG   DKD   +  AL
Sbjct: 298 LERR--SAPTVFIDAAHNPAGASALAQTLAHEFDFRFLVGVLSVLG---DKDVDGILAAL 352

Query: 340 RGL-GPVVLTRYASLRSEDPRAL 361
             +   VV+T   S R+ D  AL
Sbjct: 353 EPVFDSVVVTHNGSPRALDVEAL 375


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.322    0.145    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 818,651,519
Number of extensions: 31998423
Number of successful extensions: 77631
Number of sequences better than 1.0e-03: 1740
Number of HSP's gapped: 75577
Number of HSP's successfully gapped: 1916
Length of query: 122
Length of database: 100,000
Length adjustment: 1
Effective length of query: 121
Effective length of database: 33,550
Effective search space:  4059550
Effective search space used:  4059550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)