BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS80675.1 tthe0 AAS80675.1 GIB00176CH01 "glucose transport
system permease protein"
         (369 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y1215_PYRHO RecName: Full=Probable ABC transporter permease prot...    97   3e-22
AMYD_THETU RecName: Full=Probable starch degradation products tr...    79   5e-17
Y1038_PYRHO RecName: Full=Probable ABC transporter permease prot...    75   7e-16
YOR1_CALSR RecName: Full=Putative ABC transporter permease prote...    67   2e-13
LACF_RHIRD RecName: Full=Lactose transport system permease prote...    64   3e-12
AGLF_RHIME RecName: Full=Alpha-glucoside transport system permea...    62   6e-12
Y2990_BRUA2 RecName: Full=Probable ABC transporter permease prot...    62   8e-12
Y2783_BRUAB RecName: Full=Probable ABC transporter permease prot...    62   8e-12
MSMF_STRMU RecName: Full=Multiple sugar-binding transport system...    60   3e-11
YESP_BACSU RecName: Full=Probable ABC transporter permease prote...    60   4e-11
Y3749_BRUSU RecName: Full=Probable ABC transporter permease prot...    60   4e-11
UGPA_YERPS RecName: Full=sn-glycerol-3-phosphate transport syste...    59   7e-11
UGPA_YERPN RecName: Full=sn-glycerol-3-phosphate transport syste...    59   7e-11
UGPA_YERPE RecName: Full=sn-glycerol-3-phosphate transport syste...    59   7e-11
UGPA_YERPA RecName: Full=sn-glycerol-3-phosphate transport syste...    59   7e-11
YCJO_SHIFL RecName: Full=Inner membrane ABC transporter permease...    59   9e-11
YCJO_ECOLI RecName: Full=Inner membrane ABC transporter permease...    59   9e-11
UGPA_YERE8 RecName: Full=sn-glycerol-3-phosphate transport syste...    58   1e-10
UGPA_ERWCT RecName: Full=sn-glycerol-3-phosphate transport syste...    57   3e-10
YURN_BACSU RecName: Full=Probable ABC transporter permease prote...    54   2e-09
UGPA_SHIFL RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_SALTY RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_SALTI RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_SALPA RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_SALCH RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_ECOUT RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_ECOLI RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
UGPA_ECO57 RecName: Full=sn-glycerol-3-phosphate transport syste...    52   8e-09
Y4OQ_RHISN RecName: Full=Probable ABC transporter permease prote...    51   2e-08
ARAP_BACSU RecName: Full=L-arabinose transport system permease p...    51   2e-08
UGPA_SHIDS RecName: Full=sn-glycerol-3-phosphate transport syste...    50   2e-08
UGPA_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport syste...    49   7e-08
ARAP_BACHD RecName: Full=L-arabinose transport system permease p...    48   1e-07
UGPA_RHIME RecName: Full=sn-glycerol-3-phosphate transport syste...    48   2e-07
MALC_STRR6 RecName: Full=Maltodextrin transport system permease ...    47   2e-07
MALC_STRPN RecName: Full=Maltodextrin transport system permease ...    47   2e-07
UGPA_BRUSU RecName: Full=sn-glycerol-3-phosphate transport syste...    47   3e-07
UGPA_BRUME RecName: Full=sn-glycerol-3-phosphate transport syste...    47   3e-07
UGPA_BRUAB RecName: Full=sn-glycerol-3-phosphate transport syste...    47   3e-07
UGPA_BRUA2 RecName: Full=sn-glycerol-3-phosphate transport syste...    47   3e-07
MALG_VIBPA RecName: Full=Maltose transport system permease prote...    44   2e-06
MALF_PHOLL RecName: Full=Maltose transport system permease prote...    44   2e-06
MALG_SHIFL RecName: Full=Maltose transport system permease prote...    44   3e-06
MALG_SALTY RecName: Full=Maltose transport system permease prote...    44   3e-06
MALG_SALTI RecName: Full=Maltose transport system permease prote...    44   3e-06
MALG_ECOLI RecName: Full=Maltose transport system permease prote...    44   3e-06
MALG_ECOL6 RecName: Full=Maltose transport system permease prote...    44   3e-06
MALG_ECO57 RecName: Full=Maltose transport system permease prote...    44   3e-06
MALF_YERPE RecName: Full=Maltose transport system permease prote...    44   3e-06
MDXF_BACSU RecName: Full=Maltodextrin transport system permease ...    43   4e-06
MALG_YERPE RecName: Full=Maltose transport system permease prote...    43   4e-06
AGLG_RHIME RecName: Full=Alpha-glucoside transport system permea...    43   4e-06
MALG_ENTAE RecName: Full=Maltose transport system permease prote...    43   5e-06
MALG_PHOLL RecName: Full=Maltose transport system permease prote...    42   7e-06
YOR2_CALSR RecName: Full=Putative ABC transporter permease prote...    42   1e-05
MALG_VIBVY RecName: Full=Maltose transport system permease prote...    42   1e-05
MALG_VIBVU RecName: Full=Maltose transport system permease prote...    42   1e-05
MALG_VIBCH RecName: Full=Maltose transport system permease prote...    42   1e-05
YJ16_PYRHO RecName: Full=Probable ABC transporter permease prote...    41   1e-05
ARAQ_BACHD RecName: Full=L-arabinose transport system permease p...    41   1e-05
MSMG_STRMU RecName: Full=Multiple sugar-binding transport system...    41   2e-05
MALF_VIBVY RecName: Full=Maltose transport system permease prote...    40   2e-05
MALF_VIBVU RecName: Full=Maltose transport system permease prote...    40   2e-05
LPLB_BACSU RecName: Full=Protein lplB;                                 40   2e-05
YTEP_BACSU RecName: Full=Uncharacterized multiple-sugar transpor...    40   3e-05
Y1216_PYRHO RecName: Full=Probable ABC transporter permease prot...    40   4e-05
NOCM_AGRT5 RecName: Full=Nopaline transport system permease prot...    40   4e-05
POTC_HAEIN RecName: Full=Spermidine/putrescine transport system ...    39   7e-05
YESQ_BACSU RecName: Full=Probable ABC transporter permease prote...    39   9e-05
ARAQ_BACSU RecName: Full=L-arabinose transport system permease p...    38   2e-04
PHNU_SALTI RecName: Full=Putative 2-aminoethylphosphonate transp...    37   2e-04
NIFC_CLOPA RecName: Full=Probable transport system permease prot...    37   2e-04
HISM_SALTY RecName: Full=Histidine transport system permease pro...    37   2e-04
HISM_SALTI RecName: Full=Histidine transport system permease pro...    37   2e-04
UGPE_SALTY RecName: Full=sn-glycerol-3-phosphate transport syste...    37   3e-04
UGPE_SALTI RecName: Full=sn-glycerol-3-phosphate transport syste...    37   3e-04
UGPE_SALPA RecName: Full=sn-glycerol-3-phosphate transport syste...    37   3e-04
UGPE_SALCH RecName: Full=sn-glycerol-3-phosphate transport syste...    37   3e-04
PHNU_SALPA RecName: Full=Putative 2-aminoethylphosphonate transp...    37   3e-04
HISM_SHIFL RecName: Full=Histidine transport system permease pro...    37   3e-04
HISM_ECOLI RecName: Full=Histidine transport system permease pro...    37   3e-04
HISM_ECOL6 RecName: Full=Histidine transport system permease pro...    37   3e-04
HISM_ECO57 RecName: Full=Histidine transport system permease pro...    37   3e-04
LACG_RHIRD RecName: Full=Lactose transport system permease prote...    37   4e-04
UGPE_SHIFL RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_SHIDS RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_ECOUT RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_ECOLI RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
UGPE_ECO57 RecName: Full=sn-glycerol-3-phosphate transport syste...    36   5e-04
PHNU_SALTY RecName: Full=Putative 2-aminoethylphosphonate transp...    36   5e-04
PHNU_SALCH RecName: Full=Putative 2-aminoethylphosphonate transp...    36   5e-04
MALF_VIBCH RecName: Full=Maltose transport system permease prote...    36   5e-04
POTC_SHIFL RecName: Full=Spermidine/putrescine transport system ...    36   6e-04
POTC_ECOLI RecName: Full=Spermidine/putrescine transport system ...    36   6e-04
POTC_ECOL6 RecName: Full=Spermidine/putrescine transport system ...    36   6e-04
POTC_ECO57 RecName: Full=Spermidine/putrescine transport system ...    36   6e-04
MDXG_BACSU RecName: Full=Maltodextrin transport system permease ...    36   6e-04
MODB_ECOLI RecName: Full=Molybdenum transport system permease pr...    35   8e-04
MODB_ECO57 RecName: Full=Molybdenum transport system permease pr...    35   8e-04
CYST_PROWI RecName: Full=Probable sulfate transport system perme...    35   8e-04
CYST_CHLVU RecName: Full=Probable sulfate transport system perme...    35   8e-04

>Y1215_PYRHO RecName: Full=Probable ABC transporter permease protein
           PH1215;
          Length = 292

 Score = 96.7 bits (239), Expect = 3e-22
 Identities = 70/138 (50%), Positives = 89/138 (64%), Gaps = 1/138 (0%)

Query: 232 LALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPIT 291
           +A+  +I+A +WQ SGYTM +YLAG+R IP+E  E A +DGAS WQL+R ++ P L   T
Sbjct: 155 IAMYCIIIALIWQFSGYTMIIYLAGIRSIPIEQYEGALIDGASTWQLYRYIVIPQLTKPT 214

Query: 292 LSAMIVLGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLLAFRGNQFAKXXXXXXXXXXX 350
           LSA +VL   +LK FD ++ +  G     T + AI MY   F    FA            
Sbjct: 215 LSAFVVLMVFSLKAFDFIWVLTRGGPGTSTFILAIEMYKETFAKTNFAYGXXXXXXXXXX 274

Query: 351 XXXXXXPYLATQLRKEVR 368
                 PYL    + E R
Sbjct: 275 XXXXXXPYLYWSYKGEER 292


>AMYD_THETU RecName: Full=Probable starch degradation products
           transport system permease protein amyD;
          Length = 292

 Score = 79.3 bits (194), Expect = 5e-17
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 3/105 (2%)

Query: 236 GVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP-ITLSA 294
           G+++   WQM GY M +Y+A +  IP +++EA+++DGA+ WQ FR V+FP++AP  T+S 
Sbjct: 158 GLVIVTSWQMIGYVMVIYIAYIESIPTDLIEASKIDGANSWQQFRNVVFPLIAPAFTVSL 217

Query: 295 MIVLGHIALKIFDLVFAM-AGLDYAPTDVPAIYMYLLAFRGNQFA 338
            I L + + K+FD   ++ AG     T +  + +Y  AF   + A
Sbjct: 218 FITLSN-SFKLFDQNLSLTAGAPGNTTQMITLNIYQTAFSAQEMA 261


>Y1038_PYRHO RecName: Full=Probable ABC transporter permease protein
           PH1038;
          Length = 291

 Score = 75.5 bits (184), Expect = 7e-16
 Identities = 37/82 (45%), Positives = 56/82 (68%)

Query: 233 ALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITL 292
           AL  VIL ++W  +G++M +Y AGL  IP +  EAA +DGA+++Q+FR VI+P+L PIT+
Sbjct: 160 ALFSVILGSIWIWTGFSMLMYSAGLASIPKDYYEAALIDGANKFQIFRFVIWPLLRPITV 219

Query: 293 SAMIVLGHIALKIFDLVFAMAG 314
             + +     LKIFD+V+   G
Sbjct: 220 VIVAMTLLWDLKIFDIVYVATG 241


>YOR1_CALSR RecName: Full=Putative ABC transporter permease protein
           ORF1;Flags: Fragment;
          Length = 140

 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 231 SLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPI 290
           ++A   V+    WQ   + M  ++A L  IP E+ EAA++DGA++ Q F R+  P+L P 
Sbjct: 3   NVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFWRIELPLLTPS 62

Query: 291 TLSAMIVLGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLLAF 332
             +A I+    +LK FDL++ M  G     T++ A YMY  AF
Sbjct: 63  IKTACILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAF 105


>LACF_RHIRD RecName: Full=Lactose transport system permease protein
           lacF;
          Length = 298

 Score = 63.5 bits (153), Expect = 3e-12
 Identities = 37/104 (35%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 233 ALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITL 292
           A V +I+A  W+ +GY M  YLA L+ I   + EAA++DG   W  F  +  PML P+ L
Sbjct: 161 AKVLIIIAITWRWTGYNMIFYLAALQNIDRSIYEAAKIDGVPSWGRFAFLTIPMLKPVIL 220

Query: 293 SAMIVLGHIALKIFDLVFAMAGLDYAP---TDVPAIYMYLLAFR 333
              I      L++FD V+        P   T   ++Y+Y L FR
Sbjct: 221 FTTITSTIGTLQLFDEVYNFTEGTGGPANSTLTLSLYIYNLTFR 264


>AGLF_RHIME RecName: Full=Alpha-glucoside transport system permease
           protein aglF;
          Length = 336

 Score = 62.4 bits (150), Expect = 6e-12
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           +++  +W  +G+ M +  A LRGIP E +EAA +DGA+ WQ+F +++ P +         
Sbjct: 204 LMVILIWIQTGFAMVILSAALRGIPEETIEAAVIDGANGWQIFFKIMVPQIWGTIAVVWT 263

Query: 297 VLGHIALKIFDLVFAM 312
            +  + LK+FD+V AM
Sbjct: 264 TITILVLKVFDIVLAM 279


>Y2990_BRUA2 RecName: Full=Probable ABC transporter permease protein
           BAB2_0490;
          Length = 289

 Score = 62.0 bits (149), Expect = 8e-12
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 238 ILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
           IL  +     +T  ++L GL  IP ++ EA+ ++GAS WQ FR + FP+L P    A+++
Sbjct: 158 ILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVL 217

Query: 298 LGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLLAFRGNQFAK 339
                   F +++ M  G     TD+   ++Y LAFR  +F +
Sbjct: 218 NTIYVFNSFPIIWVMTQGRPANSTDILVTHLYKLAFRLGKFGE 260


>Y2783_BRUAB RecName: Full=Probable ABC transporter permease protein
           BruAb2_0483;
          Length = 289

 Score = 62.0 bits (149), Expect = 8e-12
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 238 ILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
           IL  +     +T  ++L GL  IP ++ EA+ ++GAS WQ FR + FP+L P    A+++
Sbjct: 158 ILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVL 217

Query: 298 LGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLLAFRGNQFAK 339
                   F +++ M  G     TD+   ++Y LAFR  +F +
Sbjct: 218 NTIYVFNSFPIIWVMTQGRPANSTDILVTHLYKLAFRLGKFGE 260


>MSMF_STRMU RecName: Full=Multiple sugar-binding transport system
           permease protein msmF;
          Length = 290

 Score = 60.1 bits (144), Expect = 3e-11
 Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 233 ALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITL 292
           A++  I   +WQ     + L+L+GL+ IP E++EAA +DGA   Q F  V  P L P   
Sbjct: 155 AVIASIFVLLWQGVAMPIILFLSGLQSIPSEIVEAAAIDGADSKQTFWSVELPYLLPSIS 214

Query: 293 SAMIVLGHIALKIFDLVFAM-AGLDYAPTDVPAIYMYLLAFRGNQF 337
              I+     L  FD +FA+  G     T    + +Y  AF+ NQ+
Sbjct: 215 MVFIMALKAGLTAFDQIFALTGGGPNNSTTSLGLLVYNYAFKSNQY 260



 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 43/121 (35%), Positives = 64/121 (52%), Gaps = 11/121 (9%)

Query: 10  VLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDV 69
           +++P +L V VF Y  + Q  + S T+W         L     FVG+ NY+ L T   D 
Sbjct: 16  LIVPLILQV-VFFYFPMFQGAFYSFTNW-------TGLTYNFDFVGINNYKILMT---DG 64

Query: 70  RFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVTGTIW 129
           +F +++   +  TL                ++   +G+ FFR  F FP  LS +    I+
Sbjct: 65  KFMKAIGFTLVLTLXXXXXXXXXXXXXXRALNAKIKGKTFFRAWFFFPAVLSGLTVSLIF 124

Query: 130 R 130
           +
Sbjct: 125 K 125


>YESP_BACSU RecName: Full=Probable ABC transporter permease protein
           yesP;
          Length = 309

 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 206 GVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVL 265
           GV+    F  G   ++L Y      + AL  +IL +VWQ  G +M ++LAGL+ IP   L
Sbjct: 143 GVINALLFFVGIDQKILWYQNP---TSALWTLILLSVWQF-GSSMLIFLAGLKNIPSSYL 198

Query: 266 EAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAI 325
           EAA VDGA+  Q F ++  P+L PI    +++    A   F   + ++  +  P D   +
Sbjct: 199 EAASVDGANRVQRFFKITLPILTPIIFFNLVMQTISAFMTFTPAYIISKGEGGPLDGTLL 258

Query: 326 Y-MYLLAFRGNQF 337
           Y +YL     N F
Sbjct: 259 YSLYLFQRAFNYF 271



 Score = 45.4 bits (106), Expect = 8e-07
 Identities = 32/148 (21%), Positives = 65/148 (43%), Gaps = 11/148 (7%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           +D +  +  + P ++    F    +G +L++S T +    A         +++GL+N++E
Sbjct: 17  KDNLAGYAFISPFIIGFLCFTVIPMGASLFLSFTSYDLFTAP--------KWIGLDNFKE 68

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMAL- 120
           +FTG  D ++ QS+     + L  +             ++ A +G   +RT+F  P  + 
Sbjct: 69  MFTG--DEKYWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFYLPSIIG 126

Query: 121 SFVVTGTIWRWLLQPQGGVNVLPTLFGL 148
             V    +WR +    G +N L    G+
Sbjct: 127 GSVAVAIMWRNIFGNDGVINALLFFVGI 154


>Y3749_BRUSU RecName: Full=Probable ABC transporter permease protein
           BRA0749;
          Length = 289

 Score = 59.7 bits (143), Expect = 4e-11
 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%)

Query: 238 ILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
           IL  +     +T  ++L GL  IP ++ EA+ ++GAS WQ FR + FP+L P    A+++
Sbjct: 158 ILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVL 217

Query: 298 LGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLLAFR 333
                   F +++ M  G     TD+   ++Y LAFR
Sbjct: 218 NTIYVFNSFPIIWVMTQGGPANSTDILVTHLYKLAFR 254



 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 106 GEGFFRTVFLFPMALSFVVTGTIWRWLLQPQGG-VNVLPTLFGLPPLSFPWLAT 158
           G    R + + P A+S  +T  +WRW L  + G +N      GL   +  WLA+
Sbjct: 96  GRSVARVIIMLPWAVSLTMTAIVWRWALNGESGMLNSALHGLGLIDTNIQWLAS 149


>UGPA_YERPS RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 294

 Score = 58.9 bits (141), Expect = 7e-11
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 210 LWAFAFGQGLRLLPYPEVH-GFSL--------ALVGVILAAVWQMSGYTMALYLAGLRGI 260
           LW F F  GL L+ +     G+S         A+  V+LA+VW+   Y    +LA L+ I
Sbjct: 125 LWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAALQSI 184

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDLVFAMAGLDYAP 319
           P  ++EAA +DGA   + F  ++ P+++P++   ++V L +     F ++ A  G     
Sbjct: 185 PKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGGGPVQ 244

Query: 320 TDVPAIY-MYLLAFRG 334
                IY +Y   F G
Sbjct: 245 ATTTLIYKIYREGFAG 260



 Score = 38.9 bits (89), Expect = 7e-05
 Identities = 36/150 (24%), Positives = 56/150 (37%), Gaps = 14/150 (9%)

Query: 6   LAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTG 65
           L +L++LP +    +F     G+ LW S+     DP     L  E  FVGL N+ +LF  
Sbjct: 13  LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ- 64

Query: 66  FVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVT 125
             D  +  S    + F+                 VD   RG   ++T+ + P        
Sbjct: 65  --DEYYLASFYTTLIFSALVAGIGLNVSLFLAAMVDYVLRGSRLYQTLLILPYXXXXXXX 122

Query: 126 GTIWRWLLQPQGGVNVLPTLFGLPPLSFPW 155
             +W +L  P  G+        L  L + W
Sbjct: 123 XXLWIFLFDPGLGL----ITHALAKLGYSW 148


>UGPA_YERPN RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 58.9 bits (141), Expect = 7e-11
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 210 LWAFAFGQGLRLLPYPEVH-GFSL--------ALVGVILAAVWQMSGYTMALYLAGLRGI 260
           LW F F  GL L+ +     G+S         A+  V+LA+VW+   Y    +LA L+ I
Sbjct: 125 LWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAALQSI 184

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDLVFAMAGLDYAP 319
           P  ++EAA +DGA   + F  ++ P+++P++   ++V L +     F ++ A  G     
Sbjct: 185 PKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGGGPVQ 244

Query: 320 TDVPAIY-MYLLAFRG 334
                IY +Y   F G
Sbjct: 245 ATTTLIYKIYREGFAG 260



 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 35/150 (23%), Positives = 56/150 (37%), Gaps = 14/150 (9%)

Query: 6   LAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTG 65
           L +L++LP +    +F     G+ LW S+     DP     L  E  FVGL N+ +LF  
Sbjct: 13  LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ- 64

Query: 66  FVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVT 125
             D  +  S    + F+                 V+   RG   ++T+ + P        
Sbjct: 65  --DEYYLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYXXXXXXX 122

Query: 126 GTIWRWLLQPQGGVNVLPTLFGLPPLSFPW 155
             +W +L  P  G+        L  L + W
Sbjct: 123 XXLWIFLFDPGLGL----ITHALAKLGYSW 148


>UGPA_YERPE RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 58.9 bits (141), Expect = 7e-11
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 210 LWAFAFGQGLRLLPYPEVH-GFSL--------ALVGVILAAVWQMSGYTMALYLAGLRGI 260
           LW F F  GL L+ +     G+S         A+  V+LA+VW+   Y    +LA L+ I
Sbjct: 125 LWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAALQSI 184

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDLVFAMAGLDYAP 319
           P  ++EAA +DGA   + F  ++ P+++P++   ++V L +     F ++ A  G     
Sbjct: 185 PKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGGGPVQ 244

Query: 320 TDVPAIY-MYLLAFRG 334
                IY +Y   F G
Sbjct: 245 ATTTLIYKIYREGFAG 260



 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 35/150 (23%), Positives = 56/150 (37%), Gaps = 14/150 (9%)

Query: 6   LAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTG 65
           L +L++LP +    +F     G+ LW S+     DP     L  E  FVGL N+ +LF  
Sbjct: 13  LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ- 64

Query: 66  FVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVT 125
             D  +  S    + F+                 V+   RG   ++T+ + P        
Sbjct: 65  --DEYYLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYXXXXXXX 122

Query: 126 GTIWRWLLQPQGGVNVLPTLFGLPPLSFPW 155
             +W +L  P  G+        L  L + W
Sbjct: 123 XXLWIFLFDPGLGL----ITHALAKLGYSW 148


>UGPA_YERPA RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 58.9 bits (141), Expect = 7e-11
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 210 LWAFAFGQGLRLLPYPEVH-GFSL--------ALVGVILAAVWQMSGYTMALYLAGLRGI 260
           LW F F  GL L+ +     G+S         A+  V+LA+VW+   Y    +LA L+ I
Sbjct: 125 LWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAALQSI 184

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDLVFAMAGLDYAP 319
           P  ++EAA +DGA   + F  ++ P+++P++   ++V L +     F ++ A  G     
Sbjct: 185 PKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGGGPVQ 244

Query: 320 TDVPAIY-MYLLAFRG 334
                IY +Y   F G
Sbjct: 245 ATTTLIYKIYREGFAG 260



 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 35/150 (23%), Positives = 56/150 (37%), Gaps = 14/150 (9%)

Query: 6   LAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTG 65
           L +L++LP +    +F     G+ LW S+     DP     L  E  FVGL N+ +LF  
Sbjct: 13  LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ- 64

Query: 66  FVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVT 125
             D  +  S    + F+                 V+   RG   ++T+ + P        
Sbjct: 65  --DEYYLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYXXXXXXX 122

Query: 126 GTIWRWLLQPQGGVNVLPTLFGLPPLSFPW 155
             +W +L  P  G+        L  L + W
Sbjct: 123 XXLWIFLFDPGLGL----ITHALAKLGYSW 148


>YCJO_SHIFL RecName: Full=Inner membrane ABC transporter permease
           protein ycjO;
          Length = 293

 Score = 58.5 bits (140), Expect = 9e-11
 Identities = 43/149 (28%), Positives = 67/149 (44%), Gaps = 17/149 (11%)

Query: 204 SAGVLLLWAFAFGQGLRLLPYPEVHGFSL-------------ALVGVILAAVWQMSGYTM 250
           S  ++  W + F  G  ++ Y  V    L             + V V+L A+W+   Y  
Sbjct: 120 SISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAF 179

Query: 251 ALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVF 310
             +LA L+ I   + EAA +DGA+ WQ FR V  P + P+ L+ ++ L  I +     +F
Sbjct: 180 ISFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPV-LATVVTLRTIWM---FYMF 235

Query: 311 AMAGLDYAPTDVPAIYMYLLAFRGNQFAK 339
           A   L     D+  +Y+Y  AF  N   K
Sbjct: 236 ADVYLLTTKVDILGVYLYKTAFAFNDLGK 264


>YCJO_ECOLI RecName: Full=Inner membrane ABC transporter permease
           protein ycjO;
          Length = 293

 Score = 58.5 bits (140), Expect = 9e-11
 Identities = 43/149 (28%), Positives = 67/149 (44%), Gaps = 17/149 (11%)

Query: 204 SAGVLLLWAFAFGQGLRLLPYPEVHGFSL-------------ALVGVILAAVWQMSGYTM 250
           S  ++  W + F  G  ++ Y  V    L             + V V+L A+W+   Y  
Sbjct: 120 SISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAF 179

Query: 251 ALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVF 310
             +LA L+ I   + EAA +DGA+ WQ FR V  P + P+ L+ ++ L  I +     +F
Sbjct: 180 ISFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPV-LATVVTLRTIWM---FYMF 235

Query: 311 AMAGLDYAPTDVPAIYMYLLAFRGNQFAK 339
           A   L     D+  +Y+Y  AF  N   K
Sbjct: 236 ADVYLLTTKVDILGVYLYKTAFAFNDLGK 264


>UGPA_YERE8 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 10/115 (8%)

Query: 210 LWAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGI 260
           LW F F  GL L+ +                 A+  V+LA+VW+   Y    +LA L+ I
Sbjct: 125 LWIFLFNPGLGLITHFLASLGYNWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAALQSI 184

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDLVFAMAG 314
           P  ++EAA +DGA   + F  ++ P+++P++   ++V L +     F ++ A  G
Sbjct: 185 PRSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATG 239



 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 32/134 (23%), Positives = 49/134 (36%), Gaps = 10/134 (7%)

Query: 6   LAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTG 65
           L +L++LP +    VF     G+ LW S+            L  E  FVGL N+  LF  
Sbjct: 13  LPYLLVLPQLAITAVFFLWPAGEALWYSV-----QMLDPFGLSSE--FVGLSNFIALFH- 64

Query: 66  FVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVT 125
             D  +  S    + F+                 VD   RG   ++T+ + P        
Sbjct: 65  --DEYYLASFYTTLIFSSLVAGIGLVVSLFLAAMVDYVLRGSRIYQTLMILPYXXXXXXX 122

Query: 126 GTIWRWLLQPQGGV 139
             +W +L  P  G+
Sbjct: 123 XXLWIFLFNPGLGL 136


>UGPA_ERWCT RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 57.0 bits (136), Expect = 3e-10
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 9/97 (9%)

Query: 210 LWAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGI 260
           LW F F  GL L+ +                 A+  V+LA+VW+   Y    +LA L+ I
Sbjct: 125 LWMFLFNPGLGLITHFLGLLGYTWNHAQDSGQAMFLVVLASVWKQISYNFLFFLAALQSI 184

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
           P  ++EA  +DGA   + F  ++ PM++P++   ++V
Sbjct: 185 PRSLVEAGAIDGAGPVRRFFNLVLPMISPVSFFLLVV 221



 Score = 45.1 bits (105), Expect = 1e-06
 Identities = 38/154 (24%), Positives = 63/154 (40%), Gaps = 14/154 (9%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           R   L ++++LP +L   +F     GQ LW S+ +   DP     L  E  FVG+EN+R+
Sbjct: 9   RSSWLPYVLVLPQLLITVIFFIWPAGQALWYSVQN--LDP---FGLSSE--FVGMENFRQ 61

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALS 121
           LF    +  +  S    + F+                 VD   R    ++T+ + P    
Sbjct: 62  LFN---NPYYLDSFYTTLIFSFLVAGFGMLISLFLAALVDYVIRASRLYQTLIILPYXXX 118

Query: 122 FVVTGTIWRWLLQPQGGVNVLPTLFGLPPLSFPW 155
                 +W +L  P  G+ ++    GL  L + W
Sbjct: 119 XXXXXXLWMFLFNP--GLGLITHFLGL--LGYTW 148


>YURN_BACSU RecName: Full=Probable ABC transporter permease protein
           yurN;
          Length = 292

 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 231 SLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPI 290
           S A++ VI  + WQ  GY   LY+  ++ IP E+ EAAR+DGA + Q F  +  P    +
Sbjct: 154 STAMLSVIFVSQWQSVGYIAMLYIVSIQKIPDELYEAARLDGAGKIQQFFHITVPQTKEM 213

Query: 291 TLSAMIVLGHIALKIFDLVFAMAGLDYA-PTDVPAIYMYLLAF 332
           +  A+++    A  +F+  + + G      ++V + ++Y  AF
Sbjct: 214 SFVAVVMTLTGAFTVFNEPYILTGGGPGKASEVLSTFLYKSAF 256



 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 40/134 (29%), Positives = 63/134 (47%), Gaps = 13/134 (9%)

Query: 26  IGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDVRFRQSVVNLIFFTLFF 85
           I +N+++SL  W        +  PE  F+GL+NY ELF    D  F Q++ N + + +  
Sbjct: 27  IFENVFLSLFQWS-------SFSPEKTFIGLKNYVELFH---DPVFYQALTNNVLYAVIS 76

Query: 86  MXXXXXXXXXXXXXV-DKAPRG-EGFFRTVFLFPMALSFVVTGTIWRWLLQPQGG-VNVL 142
           +             + DK  R    FFRTVF  P+ +S  V   ++ ++  P+ G +N L
Sbjct: 77  IVCQVFGGLILAAVLEDKLVRKWSPFFRTVFFLPVVISMTVIALLFDFIYNPETGLLNQL 136

Query: 143 PTLFGLPPLSFPWL 156
               GL  L+  WL
Sbjct: 137 LQAIGLDQLTRAWL 150


>UGPA_SHIFL RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_SALTY RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F R+  P++AP++   ++V
Sbjct: 186 RSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVV 221



 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 34/138 (24%), Positives = 52/138 (37%), Gaps = 10/138 (7%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           R R L +L++ P ++   +F     G+ LW SL     DP    +     +FVGLEN+  
Sbjct: 9   RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVA 61

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALS 121
           LF    D  +  +    I F+                 VD   RG  F++T+        
Sbjct: 62  LFH---DSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXX 118

Query: 122 FVVTGTIWRWLLQPQGGV 139
                  W +L  P  G+
Sbjct: 119 XXXXXXXWIFLFNPGRGL 136


>UGPA_SALTI RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F R+  P++AP++   ++V
Sbjct: 186 RSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVV 221



 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 34/138 (24%), Positives = 52/138 (37%), Gaps = 10/138 (7%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           R R L +L++ P ++   +F     G+ LW SL     DP    +     +FVGLEN+  
Sbjct: 9   RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVA 61

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALS 121
           LF    D  +  +    I F+                 VD   RG  F++T+        
Sbjct: 62  LFH---DSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXX 118

Query: 122 FVVTGTIWRWLLQPQGGV 139
                  W +L  P  G+
Sbjct: 119 XXXXXXXWIFLFNPGRGL 136


>UGPA_SALPA RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F R+  P++AP++   ++V
Sbjct: 186 RSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVV 221



 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 34/138 (24%), Positives = 52/138 (37%), Gaps = 10/138 (7%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           R R L +L++ P ++   +F     G+ LW SL     DP    +     +FVGLEN+  
Sbjct: 9   RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVA 61

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALS 121
           LF    D  +  +    I F+                 VD   RG  F++T+        
Sbjct: 62  LFH---DSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXX 118

Query: 122 FVVTGTIWRWLLQPQGGV 139
                  W +L  P  G+
Sbjct: 119 XXXXXXXWIFLFNPGRGL 136


>UGPA_SALCH RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F R+  P++AP++   ++V
Sbjct: 186 RSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVV 221



 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 34/138 (24%), Positives = 52/138 (37%), Gaps = 10/138 (7%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           R R L +L++ P ++   +F     G+ LW SL     DP    +     +FVGLEN+  
Sbjct: 9   RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVA 61

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALS 121
           LF    D  +  +    I F+                 VD   RG  F++T+        
Sbjct: 62  LFH---DSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXX 118

Query: 122 FVVTGTIWRWLLQPQGGV 139
                  W +L  P  G+
Sbjct: 119 XXXXXXXWIFLFNPGRGL 136


>UGPA_ECOUT RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_ECOLI RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 52.0 bits (123), Expect = 8e-09
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DGA   + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVV 221



 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 35/138 (25%), Positives = 53/138 (38%), Gaps = 10/138 (7%)

Query: 2   RDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRE 61
           R R L +L++ P ++   +F     G+ LW SL     DP    +     RFVGL+N+  
Sbjct: 9   RSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQS--VDPFGFSS-----RFVGLDNFVA 61

Query: 62  LFTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALS 121
           LF    D  +  S    I F+ F               V+   RG  F++T+        
Sbjct: 62  LFH---DSYYIDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMXXXXXXX 118

Query: 122 FVVTGTIWRWLLQPQGGV 139
                  W +L  P  G+
Sbjct: 119 XXXXXXXWIFLFNPGRGL 136


>Y4OQ_RHISN RecName: Full=Probable ABC transporter permease protein
           y4oQ;
          Length = 309

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 5/106 (4%)

Query: 231 SLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPI 290
           ++AL  VI+  VWQ + +   + LAGL+ +  + + AA+ DGA+  Q+FR +  P L P 
Sbjct: 168 TVALASVIIVDVWQSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVFRYLTLPHLVPY 227

Query: 291 TL--SAMIVLGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLLAFR 333
            +  +A  ++G +A   FD +F +  G     T   ++Y Y   F+
Sbjct: 228 IMIAAAFRIIGVMA--DFDKIFLLTLGGPGNVTTTLSVYAYNTGFK 271



 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 41/164 (25%), Positives = 66/164 (40%), Gaps = 21/164 (12%)

Query: 15  VLAVGV-FVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDVRFRQ 73
           +L +GV  VY F     + SLT W       +    +  F+GL NY ++        F  
Sbjct: 37  LLVLGVPLVYSF-----YYSLTGWS-----LVVPGSDQDFIGLLNYTDVLRSS---EFWA 83

Query: 74  SVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVTGTIWRWLL 133
           ++   + + +  +             ++    G G FR++ L PM ++  V G  W+ L 
Sbjct: 84  AIRVTLIYAVVAVSLECALGILFAVLLNLEFFGRGLFRSLMLIPMVITPAVVGIFWKLLY 143

Query: 134 QPQGGV-NVLPTLFGLPPLSFPWL----ATREQVLVFDWNRLPF 172
           +   GV N L    G  P+  PWL    A    ++V  W   PF
Sbjct: 144 EQDSGVFNYLLGTLGFEPV--PWLSLTVALASVIIVDVWQSTPF 185


>ARAP_BACSU RecName: Full=L-arabinose transport system permease
           protein araP;
          Length = 313

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 21/61 (34%), Positives = 37/61 (60%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           ++L A W+  G  +  +LAGL+ +P E+ EAA +DGA+  + F  +  P L P+T+  + 
Sbjct: 179 MVLLASWRWMGINILYFLAGLQNVPKELYEAADIDGANTMKKFLHITLPFLKPVTVYVLT 238

Query: 297 V 297
           +
Sbjct: 239 I 239


>UGPA_SHIDS RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 295

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 211 WAFAFGQGLRLLPY---------PEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIP 261
           W F F  G  L+ +                 A+  V+ A+VW+   Y    + A L+ IP
Sbjct: 126 WIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIP 185

Query: 262 VEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
             ++EAA +DG    + F ++  P++AP++   ++V
Sbjct: 186 RSLIEAAAIDGVGPIRRFFKIALPLIAPVSFFLLVV 221


>UGPA_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 293

 Score = 48.9 bits (115), Expect = 7e-08
 Identities = 32/136 (23%), Positives = 63/136 (46%), Gaps = 10/136 (7%)

Query: 3   DRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYREL 62
           ++IL +L++ P ++   +F +    Q L+ S     ++ A  L+      FVGL N+  +
Sbjct: 8   NKILPYLLVAPQIILTVIFFFWPASQALYQSTM---REDAFGLSSN----FVGLANFSAV 60

Query: 63  FTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSF 122
            +   D  +  S+   + F++                 D+  RG+GF+RT+ + P A++ 
Sbjct: 61  LS---DESYLNSLKVTVIFSVLTALVSMGLALLLATAADRVVRGKGFYRTMMIMPYAVAP 117

Query: 123 VVTGTIWRWLLQPQGG 138
            V G +W ++  P  G
Sbjct: 118 AVAGMLWLFMFNPAMG 133



 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 200 WGLASAGVLLLWAFAFGQGLRLLPY----------PEVHGFSLALVGVILAAVWQMSGYT 249
           + +A A   +LW F F   +  L Y          P + G + A++ V+ AA W+   Y 
Sbjct: 113 YAVAPAVAGMLWLFMFNPAMGTLSYILRRNGIMWDPLLDG-NQAMLLVVAAAAWKQISYN 171

Query: 250 MALYLAGLRGIPVEVLEAARVDGA 273
              ++AGL+ IP  +LEAA +DGA
Sbjct: 172 FLFFVAGLQAIPKSLLEAASIDGA 195


>ARAP_BACHD RecName: Full=L-arabinose transport system permease
           protein araP;
          Length = 316

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITL--SA 294
           +++ A W+  G  +  +LA L+ +P E+ EAA +DGA+  Q F  V  P L P+T+  + 
Sbjct: 181 MVVLASWRWMGINILYFLAALQNVPKELYEAADIDGANVVQKFFYVTLPFLKPVTIFVTT 240

Query: 295 MIVLGHIALKIFDLVFAMAG 314
           + V+G   +     VF  AG
Sbjct: 241 ISVIGGFRMFEESFVFWEAG 260


>UGPA_RHIME RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 293

 Score = 47.8 bits (112), Expect = 2e-07
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 11/94 (11%)

Query: 200 WGLASAGVLLLWAFAFGQGLRLLPY----------PEVHGFSLALVGVILAAVWQMSGYT 249
           + +A A   +LW F F   +    Y          P ++G + A++ +++AA W+   Y 
Sbjct: 113 YAVAPAVAGMLWLFMFNPAMGTFAYMLRRNGFHWDPLLNG-NHAMILIVVAAAWKQISYN 171

Query: 250 MALYLAGLRGIPVEVLEAARVDGASEWQLFRRVI 283
              ++AGL+ IP  ++EAA +DGA   + F  +I
Sbjct: 172 FLFFVAGLQAIPKSLIEAAAIDGARGTRRFWTII 205



 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 43/136 (31%), Positives = 74/136 (54%), Gaps = 10/136 (7%)

Query: 3   DRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYREL 62
           ++IL +L++ P ++   VF +    Q L+ S+    +DP    +      FVG  N+  +
Sbjct: 8   NKILPYLLVAPQIVLTIVFFFWPASQALYQSVIR--EDPFGLKS-----GFVGFANFSAV 60

Query: 63  FTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSF 122
            +   +  +  S+   + F+                  D+  RG+ F+RT+ ++P A++ 
Sbjct: 61  LS---EANYLNSLKVTVIFSXXXXXXXXXXXXXXXXXXDRVVRGKTFYRTLLIWPYAVAP 117

Query: 123 VVTGTIWRWLLQPQGG 138
            V G +W ++  P  G
Sbjct: 118 AVAGMLWLFMFNPAMG 133


>MALC_STRR6 RecName: Full=Maltodextrin transport system permease
           protein malC;
          Length = 435

 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 22/62 (35%), Positives = 34/62 (54%)

Query: 235 VGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSA 294
           + +I+   W    Y   L L  L+ IP ++ EAA +DGA+ WQ FR + FPM+  +    
Sbjct: 292 IALIMMQGWLGFPYIYVLTLGILQSIPNDLYEAAYIDGANAWQKFRNITFPMILAVAAPT 351

Query: 295 MI 296
           +I
Sbjct: 352 LI 353


>MALC_STRPN RecName: Full=Maltodextrin transport system permease
           protein malC;
          Length = 435

 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 22/62 (35%), Positives = 34/62 (54%)

Query: 235 VGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSA 294
           + +I+   W    Y   L L  L+ IP ++ EAA +DGA+ WQ FR + FPM+  +    
Sbjct: 292 IALIMMQGWLGFPYIYVLTLGILQSIPNDLYEAAYIDGANAWQKFRNITFPMILAVAAPT 351

Query: 295 MI 296
           +I
Sbjct: 352 LI 353


>UGPA_BRUSU RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 293

 Score = 47.0 bits (110), Expect = 3e-07
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 200 WGLASAGVLLLWAFAFGQGLRLLPY----------PEVHGFSLALVGVILAAVWQMSGYT 249
           + +A A   +LW F F   +    Y          P + G + A+  V++AA W+   Y 
Sbjct: 113 YAVAPAVAGMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDG-NQAMGLVVVAAAWKQISYN 171

Query: 250 MALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDL 308
              ++AGL+ IP  ++E            F  ++FP+LAP +   ++V   +     F +
Sbjct: 172 FLFFVAGLQAIPKSLIEXXXXXXXXXXXXFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGI 231

Query: 309 VFAMAG 314
           + A+ G
Sbjct: 232 IHAVTG 237



 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 44/136 (32%), Positives = 72/136 (52%), Gaps = 10/136 (7%)

Query: 3   DRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYREL 62
           ++IL + +L P ++   VF +    Q ++ S     ++ A  L    +  FV L N+  +
Sbjct: 8   NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFM---REDAFGL----KSTFVELANFTAV 60

Query: 63  FTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSF 122
            +   D  +  SV   + F                   D+  RG+ F+RT+ ++P A++ 
Sbjct: 61  LS---DPNYLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAP 117

Query: 123 VVTGTIWRWLLQPQGG 138
            V G +W ++  P  G
Sbjct: 118 AVAGMLWLFMFNPAMG 133


>UGPA_BRUME RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 291

 Score = 47.0 bits (110), Expect = 3e-07
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 200 WGLASAGVLLLWAFAFGQGLRLLPY----------PEVHGFSLALVGVILAAVWQMSGYT 249
           + +A A   +LW F F   +    Y          P + G + A+  V++AA W+   Y 
Sbjct: 114 YAVAPAVAGMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDG-NQAMGLVVVAAAWKQISYN 172

Query: 250 MALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDL 308
              ++AGL+ IP  ++E            F  ++FP+LAP +   ++V   +     F +
Sbjct: 173 FLFFVAGLQAIPKSLIEXXXXXXXXXXXXFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGI 232

Query: 309 VFAMAG 314
           + A+ G
Sbjct: 233 IHAVTG 238



 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 44/136 (32%), Positives = 72/136 (52%), Gaps = 9/136 (6%)

Query: 3   DRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYREL 62
           ++IL + +L P ++   VF +    Q ++ S     ++ A  L    +  FV L N+  +
Sbjct: 8   NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMM--REDAFGL----KSTFVELANFTAV 61

Query: 63  FTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSF 122
            +   D  +  SV   + F                   D+  RG+ F+RT+ ++P A++ 
Sbjct: 62  LS---DPNYLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAP 118

Query: 123 VVTGTIWRWLLQPQGG 138
            V G +W ++  P  G
Sbjct: 119 AVAGMLWLFMFNPAMG 134


>UGPA_BRUAB RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 293

 Score = 47.0 bits (110), Expect = 3e-07
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 200 WGLASAGVLLLWAFAFGQGLRLLPY----------PEVHGFSLALVGVILAAVWQMSGYT 249
           + +A A   +LW F F   +    Y          P + G + A+  V++AA W+   Y 
Sbjct: 113 YAVAPAVAGMLWLFIFNPAMGTFAYLLRRNGIAWDPLLDG-NQAMGLVVVAAAWKQISYN 171

Query: 250 MALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDL 308
              ++AGL+ IP  ++E            F  ++FP+LAP +   ++V   +     F +
Sbjct: 172 FLFFVAGLQAIPKSLIEXXXXXXXXXXXXFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGI 231

Query: 309 VFAMAG 314
           + A+ G
Sbjct: 232 IHAVTG 237



 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 44/136 (32%), Positives = 72/136 (52%), Gaps = 10/136 (7%)

Query: 3   DRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYREL 62
           ++IL + +L P ++   VF +    Q ++ S     ++ A  L    +  FV L N+  +
Sbjct: 8   NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFM---REDAFGL----KSTFVELANFTAV 60

Query: 63  FTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSF 122
            +   D  +  SV   + F                   D+  RG+ F+RT+ ++P A++ 
Sbjct: 61  LS---DPNYLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAP 117

Query: 123 VVTGTIWRWLLQPQGG 138
            V G +W ++  P  G
Sbjct: 118 AVAGMLWLFIFNPAMG 133


>UGPA_BRUA2 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpA;
          Length = 293

 Score = 47.0 bits (110), Expect = 3e-07
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 200 WGLASAGVLLLWAFAFGQGLRLLPY----------PEVHGFSLALVGVILAAVWQMSGYT 249
           + +A A   +LW F F   +    Y          P + G + A+  V++AA W+   Y 
Sbjct: 113 YAVAPAVAGMLWLFIFNPAMGTFAYLLRRNGIAWDPLLDG-NQAMGLVVVAAAWKQISYN 171

Query: 250 MALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV-LGHIALKIFDL 308
              ++AGL+ IP  ++E            F  ++FP+LAP +   ++V   +     F +
Sbjct: 172 FLFFVAGLQAIPKSLIEXXXXXXXXXXXXFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGI 231

Query: 309 VFAMAG 314
           + A+ G
Sbjct: 232 IHAVTG 237



 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 44/136 (32%), Positives = 72/136 (52%), Gaps = 10/136 (7%)

Query: 3   DRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYREL 62
           ++IL + +L P ++   VF +    Q ++ S     ++ A  L    +  FV L N+  +
Sbjct: 8   NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFM---REDAFGL----KSTFVELANFTAV 60

Query: 63  FTGFVDVRFRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSF 122
            +   D  +  SV   + F                   D+  RG+ F+RT+ ++P A++ 
Sbjct: 61  LS---DPNYLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAP 117

Query: 123 VVTGTIWRWLLQPQGG 138
            V G +W ++  P  G
Sbjct: 118 AVAGMLWLFIFNPAMG 133


>MALG_VIBPA RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 44.3 bits (103), Expect = 2e-06
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 216 GQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASE 275
           GQ +  L      G   A +G I   VW + GY           I   + EAA +DGA+ 
Sbjct: 148 GQYIPFLGLNTHGGLIFAYLGGIALHVWTIKGY--------FESIDSSLEEAAALDGATP 199

Query: 276 WQLFRRVIFPMLAPI-----TLSAMIVLGHI 301
           WQ FR V+ P+  PI      LS ++V+G +
Sbjct: 200 WQAFRLVLLPLSVPILAVVFILSFIMVIGEV 230


>MALF_PHOLL RecName: Full=Maltose transport system permease protein
           malF;
          Length = 518

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 231 SLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPI 290
           ++A   +I+   W    Y M L +  L+ IP ++ EA+ +DGA  +Q F ++ FP+L   
Sbjct: 370 TMARTMLIVVNAWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITFPLLIKP 429

Query: 291 TLSAMIVLGHIALKIFDLV--FAMAGLDYAPTDVPA-------IYMYLLAFRGN 335
               MI         F L+    + G D   T  PA        Y Y +AF G+
Sbjct: 430 LTPLMIASFAFNFNNFVLIQLLTLGGPDRIGTTTPAGYTDLLVSYTYRIAFDGS 483


>MALG_SHIFL RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFRLVLLPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALG_SALTY RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFRLVLLPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALG_SALTI RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFRLVLLPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALG_ECOLI RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFRLVLLPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALG_ECOL6 RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFRLVLLPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALG_ECO57 RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFRLVLLPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALF_YERPE RecName: Full=Maltose transport system permease protein
           malF;
          Length = 530

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 2/96 (2%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           +++   W    Y M L +  L+ IP ++ EA+ +DGA  +Q F R+ FP+L       MI
Sbjct: 388 ILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFRITFPLLIKPLTPLMI 447

Query: 297 VLGHIALKIFDLV--FAMAGLDYAPTDVPAIYMYLL 330
                    F L+      G D   T  PA Y  LL
Sbjct: 448 ASFAFNFNNFVLIQLLTNGGPDMIGTSTPAGYTDLL 483


>MDXF_BACSU RecName: Full=Maltodextrin transport system permease
           protein mdxF;
          Length = 435

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 23/74 (31%), Positives = 36/74 (48%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           +I+   W    Y   +    L+ IP E+ EAA++DGA+  Q FR + FPM+   T   MI
Sbjct: 293 LIMIQTWLGFPYIYVMVTGVLQAIPGELYEAAKIDGATFIQRFRHITFPMILFATAPVMI 352

Query: 297 VLGHIALKIFDLVF 310
                    F +++
Sbjct: 353 TQYTFNFNNFSIIY 366


>MALG_YERPE RecName: Full=Maltose transport system permease protein
           malG;
          Length = 303

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 168 GVIFAYMGGIALHVWTIKGY--------FETIDNSLEEAAALDGATPWQAFRLVLLPLSV 219

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 220 PI-LAVVFILSFIA 232


>AGLG_RHIME RecName: Full=Alpha-glucoside transport system permease
           protein aglG;
          Length = 380

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 247 GYTMALYLAG--LRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           G  +A+YL    + G+P E++E+ARVDGAS++ +F ++I P+  P   S  I
Sbjct: 251 GLPLAIYLLRNYMAGLPREIMESARVDGASDFDIFVKIILPLSFPALASFAI 302


>MALG_ENTAE RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYMGGIALHVWTIKGY--------FETIDGSLEEAAALDGATPWQAFRLVLVPLSV 212

Query: 289 PITLSAMIVLGHIA 302
           PI L+ + +L  IA
Sbjct: 213 PI-LAVVFILSFIA 225


>MALG_PHOLL RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G   A +G I   VW + GY           I   + EAA +DGA+ WQ FR V+ P+  
Sbjct: 161 GVIFAYLGGIALHVWTIKGY--------FETIDGSLEEAAALDGATPWQAFRMVLLPLSV 212

Query: 289 PITLSAMIVLGHIAL 303
           PI L+ + +L  I +
Sbjct: 213 PI-LAVVFILSFIGV 226


>YOR2_CALSR RecName: Full=Putative ABC transporter permease protein
           ORF2;
          Length = 275

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 23/114 (20%)

Query: 233 ALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITL 292
           AL+G  +A    MS + +  ++   R IP+E+ EAA++DG S ++L+  ++ P+ AP  +
Sbjct: 139 ALIGPYVALSLPMSIFILTEFM---REIPLELEEAAKIDGCSMFRLYSDILLPLSAPALI 195

Query: 293 SAMIVLGHIALKIFDLVFAMAGLDYAPT-----------------DVPAIYMYL 329
           +  I  G      F  VFA+  L  +PT                 D+PAI  +L
Sbjct: 196 TVGIYNGTYLWNEF--VFALV-LTSSPTRRTLPLGIWDFQARYGSDIPAIMAFL 246


>MALG_VIBVY RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 216 GQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASE 275
           GQ +  L      G   + +G I   VW + GY           I   + EAA +DGA+ 
Sbjct: 148 GQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY--------FETIDNSLEEAAALDGATP 199

Query: 276 WQLFRRVIFPMLAPITLSAMIVLGHIAL 303
           WQ FR V+ P+  PI L+ + +L  I +
Sbjct: 200 WQAFRLVLLPLSVPI-LAVVFILSFIGV 226


>MALG_VIBVU RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 216 GQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASE 275
           GQ +  L      G   + +G I   VW + GY           I   + EAA +DGA+ 
Sbjct: 148 GQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY--------FETIDNSLEEAAALDGATP 199

Query: 276 WQLFRRVIFPMLAPITLSAMIVLGHIAL 303
           WQ FR V+ P+  PI L+ + +L  I +
Sbjct: 200 WQAFRLVLLPLSVPI-LAVVFILSFIGV 226


>MALG_VIBCH RecName: Full=Maltose transport system permease protein
           malG;
          Length = 296

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 216 GQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASE 275
           GQ +  L      G   + +G I   VW + GY           I   + EAA +DGA+ 
Sbjct: 148 GQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY--------FETIDRSLEEAAALDGATP 199

Query: 276 WQLFRRVIFPMLAPITLSAMIVLGHIAL 303
           WQ FR V+ P+  PI L+ + +L  I +
Sbjct: 200 WQAFRLVLLPLSVPI-LAVVFILSFIGV 226


>YJ16_PYRHO RecName: Full=Probable ABC transporter permease protein
           PH1036;
          Length = 276

 Score = 41.2 bits (95), Expect = 1e-05
 Identities = 16/38 (42%), Positives = 29/38 (76%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
           +P +V EAA++DGA+++Q+F +++ PM  P  +SA I+
Sbjct: 164 LPTDVEEAAKIDGATDFQIFYKIVLPMALPGLISASIL 201


>ARAQ_BACHD RecName: Full=L-arabinose transport system permease
           protein araQ;
          Length = 279

 Score = 41.2 bits (95), Expect = 1e-05
 Identities = 16/40 (40%), Positives = 32/40 (80%), Gaps = 1/40 (2%)

Query: 259 GIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVL 298
           G+P E+++AAR+DG +E+ +F +++ P++ P +L+AM +L
Sbjct: 166 GLPKELMDAARIDGCTEYGIFFKIMLPLMGP-SLAAMAIL 204


>MSMG_STRMU RecName: Full=Multiple sugar-binding transport system
           permease protein msmG;
          Length = 277

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 20/63 (31%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 236 GVILAAVWQMSGYTMALYLAGLR-GIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSA 294
           G+I+  +      T+ LY+  ++  +P  + EAA +DGA +   +R++IFPML P+  + 
Sbjct: 140 GLIILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADKLTTYRKIIFPMLKPMHATT 199

Query: 295 MIV 297
           +I+
Sbjct: 200 LII 202


>MALF_VIBVY RecName: Full=Maltose transport system permease protein
           malF;
          Length = 523

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 15/110 (13%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFP-MLAPITLSAM 295
           V++   W    Y M L +  L+ IP ++ EA+ +DGA+  Q F RV  P M+ P+T    
Sbjct: 381 VLIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNFTRVTLPLMIKPLT---P 437

Query: 296 IVLGHIALKIFDLVFAMAGLDYAP-----------TDVPAIYMYLLAFRG 334
           +++   A    + V         P           TD+   Y Y +AF G
Sbjct: 438 LLIASFAFNFNNFVMIQLLTQGGPNMIGTSEPAGYTDLLVSYTYRIAFEG 487


>MALF_VIBVU RecName: Full=Maltose transport system permease protein
           malF;
          Length = 523

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 15/110 (13%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFP-MLAPITLSAM 295
           V++   W    Y M L +  L+ IP ++ EA+ +DGA+  Q F RV  P M+ P+T    
Sbjct: 381 VLIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNFTRVTLPLMIKPLT---P 437

Query: 296 IVLGHIALKIFDLVFAMAGLDYAP-----------TDVPAIYMYLLAFRG 334
           +++   A    + V         P           TD+   Y Y +AF G
Sbjct: 438 LLIASFAFNFNNFVMIQLLTQGGPNMIGTSEPAGYTDLLVSYTYRIAFEG 487


>LPLB_BACSU RecName: Full=Protein lplB;
          Length = 318

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 23/96 (23%), Positives = 50/96 (52%), Gaps = 2/96 (2%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           +++ ++W+ +G+   L+LA L  +  E  EAA +DGA  ++    +  P +    +  +I
Sbjct: 182 IVMQSIWKETGWGTILFLAALATVDQEQYEAAIMDGAGRFRRMWHITLPAIRSTIIVLLI 241

Query: 297 V-LGHIALKIFDLVFAMA-GLDYAPTDVPAIYMYLL 330
           + +G      F+ V+ M   L+ +  D+   Y+Y++
Sbjct: 242 LRIGSFLNLGFEQVYLMTNSLNRSVADIFDTYVYMM 277


>YTEP_BACSU RecName: Full=Uncharacterized multiple-sugar transport
           system permease yteP;
          Length = 321

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 25/105 (23%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 238 ILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIV 297
           IL  +W+ +G++  +YLA +  +  ++ EAA++DGA   +    +  P +  + +  +I+
Sbjct: 186 ILQVIWREAGWSTIIYLAAITAVDPQLYEAAKMDGAGRLRQMWHITLPAIKSVIVVLLIL 245

Query: 298 -LGHIALKIFDLVFAMAGLDYAPTDVPAI---YMYLLAFRGNQFA 338
            +G      F+ V+ +  L+    +V  I   Y+Y    +  QF+
Sbjct: 246 KIGDTLELGFEHVYLL--LNATNREVAEIFDTYVYTAGLKQGQFS 288


>Y1216_PYRHO RecName: Full=Probable ABC transporter permease protein
           PH1216;
          Length = 275

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 11/98 (11%)

Query: 193 GERRRALWGLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGY---- 248
           G   R L  L S G+ L +         L+P  ++   SL L   IL  +   + Y    
Sbjct: 99  GRVSRQLLALISFGIFLPYQSI------LIPLVKIIS-SLGLYNRILGLILTHTAYGIPI 151

Query: 249 TMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPM 286
           T  L+      IP E++EAA++DGA  W+++ +VI P+
Sbjct: 152 TTLLFTNYYYEIPDELVEAAKIDGADPWKIYTKVILPL 189


>NOCM_AGRT5 RecName: Full=Nopaline transport system permease protein
           nocM;
          Length = 241

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 16/108 (14%)

Query: 238 ILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSA--- 294
           ILA     + YT  +   G++ + +  +EAAR  G S +  FRR++FP+     L A   
Sbjct: 100 ILALALNTAAYTSEIIRGGIQSVSLGQIEAARAVGMSTFLQFRRIVFPIAIRQALPAYGN 159

Query: 295 --MIVLGHIALKIFDLVFAMAGL-------DYAPTDV----PAIYMYL 329
             M+++   +L     +  + GL        Y+P +V     AIY+++
Sbjct: 160 EVMLIIKSTSLASTITIVEVTGLAKQIISATYSPVEVFIVAGAIYLFI 207


>POTC_HAEIN RecName: Full=Spermidine/putrescine transport system
           permease protein potC;
          Length = 257

 Score = 38.9 bits (89), Expect = 7e-05
 Identities = 23/71 (32%), Positives = 35/71 (49%)

Query: 227 VHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPM 286
           V G SL    ++LA V     Y      + L G    +LEAA+  GASE  + R++I P+
Sbjct: 121 VVGISLGFWSLLLAHVTFCLPYVTVTIFSRLNGFDSRMLEAAKDLGASEVTILRKIILPL 180

Query: 287 LAPITLSAMIV 297
             P  +S  ++
Sbjct: 181 ALPAVVSGWLL 191


>YESQ_BACSU RecName: Full=Probable ABC transporter permease protein
           yesQ;
          Length = 296

 Score = 38.5 bits (88), Expect = 9e-05
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 252 LYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           L +  +R IP E+ EAAR+DG   +  F R+I P++AP   ++ I
Sbjct: 176 LMIQFIRTIPEELDEAARIDGCGRFACFWRIILPLIAPALATSAI 220


>ARAQ_BACSU RecName: Full=L-arabinose transport system permease
           protein araQ;
          Length = 281

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 16/40 (40%), Positives = 30/40 (75%), Gaps = 1/40 (2%)

Query: 259 GIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVL 298
           G+P ++L++AR+DG +E+ +F R++ P++ P    AMI+L
Sbjct: 168 GLPRDLLDSARMDGCTEFGIFFRIMAPLMKP-AFGAMIIL 206


>PHNU_SALTI RecName: Full=Putative 2-aminoethylphosphonate transport
           system permease protein phnU;
          Length = 289

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 201 GLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGI 260
           GL +  ++ L+AF           P V  F  ++ GVILA +   +   M   +A LR I
Sbjct: 131 GLLNGALMSLFAFEL---------PPVD-FLYSMQGVILAEITVFTPLVMRPLMAALRQI 180

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSA 294
               LEAA + GA   ++  +VIFP   P  +++
Sbjct: 181 DKSQLEAASILGAHPLRVIGQVIFPAALPALMAS 214


>NIFC_CLOPA RecName: Full=Probable transport system permease protein
           nifC;
          Length = 286

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 203 ASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVG--VILAAVWQMSGYTMALYLAGLRGI 260
           A AG+ LL   AFG+   +  +   HG ++      VI+A  +  S   + +    ++ +
Sbjct: 125 AVAGIALL--LAFGKNGVVGNFLSNHGINVIFTSTAVIIAQFFVSSALYVRVLRDSVKSV 182

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAG 314
           P+E+ E + V GA + +   +++ PML    +S +I+    +L  F      AG
Sbjct: 183 PIELFEVSYVLGAGKIETIIKIMIPMLKKSIVSGLILAWIRSLGEFGATLMFAG 236


>HISM_SALTY RecName: Full=Histidine transport system permease
           protein hisM;
          Length = 235

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F   L   +LA       YT  ++   +R +P   +EAAR  G S ++++R +I P    
Sbjct: 98  FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALR 157

Query: 290 ITLSA 294
           I L A
Sbjct: 158 IALPA 162


>HISM_SALTI RecName: Full=Histidine transport system permease
           protein hisM;
          Length = 235

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F   L   +LA       YT  ++   +R +P   +EAAR  G S ++++R +I P    
Sbjct: 98  FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALR 157

Query: 290 ITLSA 294
           I L A
Sbjct: 158 IALPA 162


>UGPE_SALTY RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + FR ++ P L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFRDIVLP-LSKTNLAALFVITFI 209


>UGPE_SALTI RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + FR ++ P L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFRDIVLP-LSKTNLAALFVITFI 209


>UGPE_SALPA RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + FR ++ P L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFRDIVLP-LSKTNLAALFVITFI 209


>UGPE_SALCH RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + FR ++ P L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFRDIVLP-LSKTNLAALFVITFI 209


>PHNU_SALPA RecName: Full=Putative 2-aminoethylphosphonate transport
           system permease protein phnU;
          Length = 289

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 201 GLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGI 260
           GL +  ++ L+AF           P V  F  ++ GVILA +   +   M   +A LR I
Sbjct: 131 GLLNGALMSLFAFEL---------PPVD-FLYSMQGVILAEITVFTPLVMRPLMAALRQI 180

Query: 261 PVEVLEAARVDGASEWQLFRRVIFPMLAPITLS 293
               LEAA + GA   ++  +VIFP   P  ++
Sbjct: 181 DKSQLEAASILGAHPLRVIGQVIFPAALPALMA 213


>HISM_SHIFL RecName: Full=Histidine transport system permease
           protein hisM;
          Length = 238

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F   L   +LA       YT  ++   +R +P   +EAAR  G S ++++R +I P    
Sbjct: 98  FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALR 157

Query: 290 ITLSA 294
           I L A
Sbjct: 158 IALPA 162


>HISM_ECOLI RecName: Full=Histidine transport system permease
           protein hisM;
          Length = 238

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F   L   +LA       YT  ++   +R +P   +EAAR  G S ++++R +I P    
Sbjct: 98  FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALR 157

Query: 290 ITLSA 294
           I L A
Sbjct: 158 IALPA 162


>HISM_ECOL6 RecName: Full=Histidine transport system permease
           protein hisM;
          Length = 238

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F   L   +LA       YT  ++   +R +P   +EAAR  G S ++++R +I P    
Sbjct: 98  FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALR 157

Query: 290 ITLSA 294
           I L A
Sbjct: 158 IALPA 162


>HISM_ECO57 RecName: Full=Histidine transport system permease
           protein hisM;
          Length = 238

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F   L   +LA       YT  ++   +R +P   +EAAR  G S ++++R +I P    
Sbjct: 98  FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALR 157

Query: 290 ITLSA 294
           I L A
Sbjct: 158 IALPA 162


>LACG_RHIRD RecName: Full=Lactose transport system permease protein
           lacG;
          Length = 273

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 246 SGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVL 298
           S + +  +    +  P E+ +AA+VDG  EWQ+F  +  P++     +A +++
Sbjct: 149 SAFIIFYFRQASKAFPTELRDAAKVDGLKEWQIFFYIYVPVMRSTYAAAFVIV 201


>UGPE_SHIFL RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_SHIDS RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_ECOUT RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_ECOLI RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>UGPE_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system
           permease protein ugpE;
          Length = 281

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 260 IPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI 301
           +P E++EAAR+DGAS  + F  ++FP L+   L+A+ V+  I
Sbjct: 169 LPDELVEAARIDGASPMRFFCDIVFP-LSKTNLAALFVITFI 209


>PHNU_SALTY RecName: Full=Putative 2-aminoethylphosphonate transport
           system permease protein phnU;
          Length = 286

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 22/64 (34%), Positives = 33/64 (51%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F  ++ GVILA +   +   M   +A LR I    LEAA + GA   ++  +VIFP   P
Sbjct: 150 FLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALP 209

Query: 290 ITLS 293
             ++
Sbjct: 210 ALMA 213


>PHNU_SALCH RecName: Full=Putative 2-aminoethylphosphonate transport
           system permease protein phnU;
          Length = 286

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 22/64 (34%), Positives = 33/64 (51%)

Query: 230 FSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP 289
           F  ++ GVILA +   +   M   +A LR I    LEAA + GA   ++  +VIFP   P
Sbjct: 150 FLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALP 209

Query: 290 ITLS 293
             ++
Sbjct: 210 ALMA 213


>MALF_VIBCH RecName: Full=Maltose transport system permease protein
           malF;
          Length = 524

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 15/115 (13%)

Query: 232 LALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFP-MLAPI 290
           LA   V++   W    Y M   +  L+ IP ++ EA+ +DGA+    F ++  P M+ P+
Sbjct: 377 LAKTMVLIVNTWLGFPYMMIFCMGLLKAIPDDLYEASAIDGANFIHNFTKITLPMMIKPL 436

Query: 291 TLSAMIVLGHIALKIFDLVFAMAGLDYAP-----------TDVPAIYMYLLAFRG 334
           T    +++   A    + V         P           TD+   Y Y +AF G
Sbjct: 437 T---PLLIASFAFNFNNFVMIQLLTQGGPNRIGTSEPAGYTDLLVSYTYRIAFEG 488


>POTC_SHIFL RecName: Full=Spermidine/putrescine transport system
           permease protein potC;
          Length = 264

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G  L    ++ + +     + +    + L+G  V +LEAA+  GASE+ + R++I P+  
Sbjct: 123 GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAM 182

Query: 289 PITLSAMIV 297
           P   +  ++
Sbjct: 183 PAVAAGWVL 191


>POTC_ECOLI RecName: Full=Spermidine/putrescine transport system
           permease protein potC;
          Length = 264

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G  L    ++ + +     + +    + L+G  V +LEAA+  GASE+ + R++I P+  
Sbjct: 123 GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAM 182

Query: 289 PITLSAMIV 297
           P   +  ++
Sbjct: 183 PAVAAGWVL 191


>POTC_ECOL6 RecName: Full=Spermidine/putrescine transport system
           permease protein potC;
          Length = 264

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G  L    ++ + +     + +    + L+G  V +LEAA+  GASE+ + R++I P+  
Sbjct: 123 GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAM 182

Query: 289 PITLSAMIV 297
           P   +  ++
Sbjct: 183 PAVAAGWVL 191


>POTC_ECO57 RecName: Full=Spermidine/putrescine transport system
           permease protein potC;
          Length = 264

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G  L    ++ + +     + +    + L+G  V +LEAA+  GASE+ + R++I P+  
Sbjct: 123 GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAM 182

Query: 289 PITLSAMIV 297
           P   +  ++
Sbjct: 183 PAVAAGWVL 191


>MDXG_BACSU RecName: Full=Maltodextrin transport system permease
           protein mdxG;
          Length = 278

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 236 GVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPI 290
           G I    W M GY           +P E+ EAAR+DGA   ++F  ++ P++ P+
Sbjct: 149 GGIPMNTWLMKGY--------FDTVPREIDEAARIDGAGHLRIFASIVLPLVKPM 195


>MODB_ECOLI RecName: Full=Molybdenum transport system permease
           protein modB;
          Length = 229

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           V+ AAV        A+ LA L G+ V++ +AAR  GA  W    RV F +  P+TL  +I
Sbjct: 96  VLAAAVMSFPLMVRAIRLA-LEGVDVKLEQAARTLGAGRW----RVFFTITLPLTLPGII 150

Query: 297 V 297
           V
Sbjct: 151 V 151


>MODB_ECO57 RecName: Full=Molybdenum transport system permease
           protein modB;
          Length = 229

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
           V+ AAV        A+ LA L G+ V++ +AAR  GA  W    RV F +  P+TL  +I
Sbjct: 96  VLAAAVMSFPLMVRAIRLA-LEGVDVKLEQAARTLGAGRW----RVFFTITLPLTLPGII 150

Query: 297 V 297
           V
Sbjct: 151 V 151


>CYST_PROWI RecName: Full=Probable sulfate transport system permease
           protein cysT;
          Length = 255

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 236 GVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAP-----I 290
           GV+LA ++    + +      L+G+   + EAA   GAS +Q F RVIFP L P      
Sbjct: 124 GVLLAMIFVSFPFVIRSLQPVLQGLDHGLEEAAWCLGASSFQTFLRVIFPTLVPALVTGF 183

Query: 291 TLSAMIVLG 299
           TLS    LG
Sbjct: 184 TLSFSRALG 192


>CYST_CHLVU RecName: Full=Probable sulfate transport system permease
           protein cysT;
          Length = 266

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 229 GFSLAL--VGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPM 286
           GF +    +GV+LA ++    + +      L+ +   + EAA   GAS W+ FR+VI P 
Sbjct: 126 GFQIVFTKIGVLLAMIFVSFPFVIRTLQPVLQEMEKSLEEAAWSLGASSWETFRKVILPT 185

Query: 287 LAP-----ITLSAMIVLG 299
           L P      TLS    LG
Sbjct: 186 LWPALFTGFTLSFSRALG 203


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.320    0.143    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,813,203,204
Number of extensions: 341429966
Number of successful extensions: 909975
Number of sequences better than 1.0e-03: 23546
Number of HSP's gapped: 873173
Number of HSP's successfully gapped: 35067
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)