BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS81728.1 tthe0 AAS81728.1 GIB00176CH01 "S1 domain protein"
         (142 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    70   1e-14
PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferas...    70   1e-14
PNP_VARPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    70   1e-14
PNP_RHOFD RecName: Full=Polyribonucleotide nucleotidyltransferas...    69   3e-14
PNP_HAHCH RecName: Full=Polyribonucleotide nucleotidyltransferas...    69   3e-14
PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   4e-14
PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   6e-14
PNP_COXBU RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   6e-14
PNP_COXBR RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   6e-14
PNP_COXBN RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   6e-14
PNP_COXB2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   6e-14
PNP_COXB1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    68   6e-14
PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferas...    67   7e-14
PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferas...    67   1e-13
PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferas...    67   1e-13
PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    67   1e-13
PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferas...    67   1e-13
PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferas...    66   2e-13
PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    66   2e-13
PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferas...    66   2e-13
PNP_CLOPH RecName: Full=Polyribonucleotide nucleotidyltransferas...    66   2e-13
PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferas...    66   2e-13
PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferas...    66   2e-13
PNP_SACD2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    65   3e-13
PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferas...    65   5e-13
PNP_ALHEH RecName: Full=Polyribonucleotide nucleotidyltransferas...    65   5e-13
PNP_PSYA2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   6e-13
PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   6e-13
PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   6e-13
PNP_PSYCK RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   8e-13
PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   8e-13
PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   8e-13
YABR_BACSU RecName: Full=Uncharacterized protein yabR;                 64   1e-12
PNP_MARMS RecName: Full=Polyribonucleotide nucleotidyltransferas...    64   1e-12
PNP_PSYWF RecName: Full=Polyribonucleotide nucleotidyltransferas...    63   1e-12
PNP_LEPCP RecName: Full=Polyribonucleotide nucleotidyltransferas...    63   1e-12
PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferas...    63   2e-12
PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferas...    63   2e-12
PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   2e-12
PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_PELTS RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   3e-12
PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransfera...    62   3e-12
PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferas...    62   4e-12
PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_NITOC RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_NITEC RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_AZOSE RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   5e-12
PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferas...    61   7e-12
PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   9e-12
PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   9e-12
PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   9e-12
PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_BURP8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_ACTPJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_ACTP7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP_ACTP2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   1e-11
PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransfera...    60   1e-11
PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_ACIF5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_ACIF2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    60   2e-11
PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   2e-11
PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_NEIMA RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_GEOSL RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_METCA RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_CAUSK RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_BURXL RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferas...    59   3e-11
PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransfera...    59   3e-11
PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   4e-11
PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   4e-11
PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   4e-11
PNP_BART1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   4e-11
PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   4e-11
PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_SHESH RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_SHEPW RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_SHEPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_SHEHH RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_METPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_METEP RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_METC4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_IDILO RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_HAES2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_HAES1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_BIFLO RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_BIFLI RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_BIFLD RecName: Full=Polyribonucleotide nucleotidyltransferas...    58   6e-11
PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_GEOLS RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   8e-11
PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_MANSM RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_LEGPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_GLOVI RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_FINM2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_CAUCR RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_CAUCN RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_BARBK RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_HAEDU RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_GEOUR RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_GEOSF RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_DEIDV RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_BARHE RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferas...    57   1e-10
PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_SINMW RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RHISN RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RHIME RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RHIL3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_GEOSM RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_GEOBB RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_CHLMU RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACCR RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_AGRT5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_STAS1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_LEGPH RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP_LEGPC RecName: Full=Polyribonucleotide nucleotidyltransferas...    56   2e-10
PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransfera...    56   2e-10
RS1_STAHJ RecName: Full=30S ribosomal protein S1;                      55   3e-10
PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   3e-10
PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   3e-10
PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   3e-10
PNP_RHIEC RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   3e-10
PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   3e-10
PNP_MOOTA RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   3e-10
PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_DESHY RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_DESHD RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_BACSK RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_AGRVS RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   4e-10
PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_LEGPL RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_GEOMG RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_CHLPN RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferas...    55   5e-10
PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_THET8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_SHEB9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_SHEB8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_SHEB5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_RICBR RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_RICB8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_PELCD RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_MESSB RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURP6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURP1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURP0 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   6e-10
RS1_STAAW RecName: Full=30S ribosomal protein S1;                      54   8e-10
RS1_STAAS RecName: Full=30S ribosomal protein S1;                      54   8e-10
RS1_STAAR RecName: Full=30S ribosomal protein S1;                      54   8e-10
RS1_STAAN RecName: Full=30S ribosomal protein S1;                      54   8e-10
RS1_STAAM RecName: Full=30S ribosomal protein S1;                      54   8e-10
RS1_STAAC RecName: Full=30S ribosomal protein S1;                      54   8e-10
PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_RICM5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_RICFE RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_RICAH RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_CLOPE RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_CLOP1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_CHLFF RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_CHLCV RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_BIFA0 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   8e-10
PNP_STAHJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_STAES RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_STAEQ RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_EXISA RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_BLOFL RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferas...    54   1e-09
PNP_RICRS RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_RICRO RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_RICPU RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_RICCN RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_RICAE RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_PELPD RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_DEIRA RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_CLOTH RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   1e-09
GS13_BACSU RecName: Full=General stress protein 13;         Shor...    53   1e-09
RS1_STAS1 RecName: Full=30S ribosomal protein S1;                      53   2e-09
RS1H_BACC1 RecName: Full=30S ribosomal protein S1 homolog;             53   2e-09
PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_HAMD5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_CLOPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_ANASK RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_ANADE RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_ANAD2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    53   2e-09
PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   2e-09
PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   2e-09
PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   2e-09
PNP_STACT RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   2e-09
PNP_GEMAT RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   2e-09
PNP_ELUMP RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   2e-09
ISPH_CLOTE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphat...    52   2e-09
RS1_LEULA RecName: Full=40S ribosomal protein S1;                      52   3e-09
PNP_SULAA RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_STRTD RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_STRT2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_STRT1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_RICCK RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_OCHA4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
PNP_CHLAB RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   3e-09
IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit...    52   3e-09
PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_RICTY RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_DEIGD RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUSU RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUSI RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUO2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUME RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUMB RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUC2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUAB RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUA2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_BRUA1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    52   4e-09
PNP_RICPR RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_NATTJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_GLUOX RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_DESRM RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_CYAP8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   5e-09
PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   7e-09
PNP_PELUB RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   7e-09
PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   7e-09
PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    51   7e-09
IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit...    51   7e-09
IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit...    51   7e-09
RR1_SPIOL RecName: Full=30S ribosomal protein S1, chloroplastic;...    50   9e-09
PNP_THISH RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_MICAN RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_LEPBP RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_LEPBA RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_DESAP RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
PNP_ANADF RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   9e-09
RS1_STAEQ RecName: Full=30S ribosomal protein S1;                      50   1e-08
PNP_TREDE RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_SALRD RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_ROSDO RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_DINSH RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_CYAP4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
PNP_AKKM8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   1e-08
IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit...    50   1e-08
RS1H_BACSU RecName: Full=30S ribosomal protein S1 homolog;             50   2e-08
PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   2e-08
PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   2e-08
PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   2e-08
PNP_MACCJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   2e-08
PNP_JANSC RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   2e-08
PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    50   2e-08
IF2A_METJA RecName: Full=Translation initiation factor 2 subunit...    50   2e-08
IF2A_HALMA RecName: Full=Translation initiation factor 2 subunit...    50   2e-08
PNP_SORC5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_PERMH RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   2e-08
IF2A_THEON RecName: Full=Translation initiation factor 2 subunit...    49   2e-08
PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   3e-08
PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   3e-08
PNP_EHRCR RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   3e-08
RS1_SYNP6 RecName: Full=30S ribosomal protein S1;                      49   4e-08
PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   4e-08
PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   4e-08
PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   4e-08
PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   4e-08
PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   4e-08
PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferas...    49   4e-08
RS1A_SYNY3 RecName: Full=30S ribosomal protein S1 homolog A;           48   5e-08
PNP_SOLUE RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   5e-08
PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   5e-08
PNP_COPPD RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   5e-08
PNP_ANAPZ RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   5e-08
IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit...    48   5e-08
IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit...    48   5e-08
PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_SALAI RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_BRAHW RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_BEUC1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    48   6e-08
PNP_EHRCJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   8e-08
PNP_CORA7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   8e-08
PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   8e-08
PNP_ANAVT RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   8e-08
PNP_ANASP RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   8e-08
IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit...    47   8e-08
PNP_THERP RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_SACEN RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_NOSP7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_EHRRW RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_EHRRG RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_ACIC1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
MOG5_CAEEL RecName: Full=Probable pre-mRNA-splicing factor ATP-d...    47   1e-07
PNP_STRAT RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferas...    47   1e-07
PNP_CHLPD RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRGG RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRCO RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STRAW RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAW RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAT RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAS RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAR RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAN RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAM RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAE RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAC RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAAB RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAA9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAA8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAA3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAA2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_STAA1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_SALTO RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_RHOBA RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_NITSB RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
PNP_BLOPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    46   2e-07
RS1_HELPY RecName: Full=30S ribosomal protein S1;                      45   3e-07
PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   3e-07
IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit...    45   3e-07
PNP_CORU7 RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   4e-07
PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   5e-07
PNP_THEFY RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   5e-07
PNP_SULDN RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   5e-07
PNP_SPICI RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   5e-07
PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   5e-07
PNP_NOCFA RecName: Full=Polyribonucleotide nucleotidyltransferas...    45   5e-07
ISPH_CLOAB RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphat...    45   5e-07
PNP_RHOE4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   7e-07
PNP_PELLD RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   7e-07
PNP_PSESM RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_PROVI RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_NEOSM RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_ARTS2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_ARTCA RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
PNP_ARTAT RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   9e-07
RS1_CHLTR RecName: Full=30S ribosomal protein S1;                      44   1e-06
PNP_UNCTG RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCTU RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCTA RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCPA RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCMM RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCBT RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCBP RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCBO RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_MYCA1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    44   1e-06
PNP_PHYMT RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_ORITI RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_ORITB RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_MYCUA RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_MYCA9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_MICLC RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_KINRD RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_DEHE1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_CORDI RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   1e-06
RS1_CHLMU RecName: Full=30S ribosomal protein S1;AltName: Full=7...    43   2e-06
PNP_SULNB RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   2e-06
PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   2e-06
PNP_CARHZ RecName: Full=Polyribonucleotide nucleotidyltransferas...    43   2e-06
RS1_CHLPN RecName: Full=30S ribosomal protein S1;                      42   3e-06
PNP_FRASN RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   3e-06
PNP_MYCLE RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   3e-06
PNP_MYCLB RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   3e-06
PNP_KOCRD RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   3e-06
PNP_COREF RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   3e-06
PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   3e-06
IF2A_METST RecName: Full=Translation initiation factor 2 subunit...    42   3e-06
RS1_COXBU RecName: Full=30S ribosomal protein S1;                      42   4e-06
PNP_METS4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   4e-06
PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   4e-06
PNP_METFK RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   4e-06
PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferas...    42   4e-06
PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
PNP_METNO RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
PNP_FRASC RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
PNP_DICT6 RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
PNP_CLAMS RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
PNP_CLAM3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
PNP_ACHLI RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   6e-06
YHGF_ECOLI RecName: Full=Protein yhgF;                                 41   7e-06
RS1_HELPJ RecName: Full=30S ribosomal protein S1;                      41   7e-06
PNP_PROAC RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   7e-06
PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   7e-06
PNP_GRAFK RecName: Full=Polyribonucleotide nucleotidyltransferas...    41   7e-06
PNP_RENSM RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_MYCVP RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_MYCSS RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_MYCSK RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_MYCSJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_MYCGI RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_CORK4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_CORJK RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_CHLCH RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
IF2A_METTH RecName: Full=Translation initiation factor 2 subunit...    40   1e-05
IF2A_METKA RecName: Full=Translation initiation factor 2 subunit...    40   1e-05
PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_METRJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_FLAPJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
PNP_ANATD RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   1e-05
ISPH_FUSNN RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphat...    40   1e-05
PNP_PELPB RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   2e-05
PNP_MAGSM RecName: Full=Polyribonucleotide nucleotidyltransferas...    40   2e-05
IF2A_METS3 RecName: Full=Translation initiation factor 2 subunit...    40   2e-05
PNP_RHOSR RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
PNP_RHOOB RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
PNP_NOCSJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
PNP_MYCS2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
PNP_FRAAA RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
PNP_CALS8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
PNP_BREBN RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   2e-05
Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;               39   3e-05
PNP_WOLPP RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   3e-05
PNP_LACLS RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   3e-05
PNP_LACLM RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   3e-05
PNP_AERS4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   3e-05
RS1_BUCBP RecName: Full=30S ribosomal protein S1;                      39   4e-05
PNP_SULSY RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   4e-05
PNP_PROA2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   4e-05
PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   4e-05
PNP_LEIXX RecName: Full=Polyribonucleotide nucleotidyltransferas...    39   4e-05
IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit...    39   4e-05
RS1_BUCAP RecName: Full=30S ribosomal protein S1;                      38   5e-05
RR1_PORPU RecName: Full=30S ribosomal protein S1, chloroplastic;       38   5e-05
PNP_SULMW RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   5e-05
PNP_PROM9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   5e-05
RS1_PSEAE RecName: Full=30S ribosomal protein S1;                      38   6e-05
RS1_PROSP RecName: Full=30S ribosomal protein S1;Flags: Fragment;      38   6e-05
PNP_PROMS RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_PROMP RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_PROM5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_PROM2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_PROM0 RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_FLAJ1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
PNP_ARCB4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    38   6e-05
RS1_RHOPA RecName: Full=30S ribosomal protein S1;AltName: Full=R...    37   8e-05
RS1_HAEIN RecName: Full=30S ribosomal protein S1;                      37   8e-05
RS1_BUCAI RecName: Full=30S ribosomal protein S1;                      37   8e-05
PNP_WOLSU RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   8e-05
PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   8e-05
PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   8e-05
RS1_SHIFL RecName: Full=30S ribosomal protein S1;                      37   1e-04
RS1_RHIME RecName: Full=30S ribosomal protein S1;                      37   1e-04
RS1_ECOLI RecName: Full=30S ribosomal protein S1;                      37   1e-04
RS1_ECOL6 RecName: Full=30S ribosomal protein S1;                      37   1e-04
RS1_ECO57 RecName: Full=30S ribosomal protein S1;                      37   1e-04
PNP_WIGBR RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
RS1_MYCTU RecName: Full=30S ribosomal protein S1;                      37   1e-04
RS1_MYCLE RecName: Full=30S ribosomal protein S1;                      37   1e-04
PNP_GLUDA RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
PNP_CHLL2 RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
PNP_AZOC5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
PNP_ANAMM RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
PNP_ANAMF RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferas...    37   1e-04
IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit...    37   1e-04
PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferas...    36   2e-04
PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    36   2e-04
RR1_PORYE RecName: Full=30S ribosomal protein S1, chloroplastic;       36   2e-04
PNP_WOLTR RecName: Full=Polyribonucleotide nucleotidyltransferas...    36   2e-04
PNP_SYNJA RecName: Full=Polyribonucleotide nucleotidyltransferas...    36   2e-04
PNP_METSB RecName: Full=Polyribonucleotide nucleotidyltransferas...    36   2e-04
TEX_BORPE RecName: Full=Protein tex;                                   35   3e-04
RS1_NEIMB RecName: Full=30S ribosomal protein S1;                      35   3e-04
PNP_RHORT RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   3e-04
PNP_PARL1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   3e-04
PNP_TROWT RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   4e-04
PNP_TROW8 RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   4e-04
PNP_STRMK RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   4e-04
PNP_STRM5 RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   4e-04
PNP_BRAJA RecName: Full=Polyribonucleotide nucleotidyltransferas...    35   4e-04
YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;              34   7e-04
YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;              34   7e-04
PRP22_YEAST RecName: Full=Pre-mRNA-splicing factor ATP-dependent...    34   7e-04
PNP_STRE4 RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   7e-04
PNP_PROMM RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   7e-04
PNP_PROM3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   7e-04
PNP_HYDS0 RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   7e-04
PNP_ACAM1 RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   7e-04
PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   9e-04
PNP_CHLT3 RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   9e-04
PNP_BEII9 RecName: Full=Polyribonucleotide nucleotidyltransferas...    34   9e-04

>PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 70.1 bits (170), Expect = 1e-14
 Identities = 36/75 (48%), Positives = 48/75 (64%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++EAG            FGAFVE+  G++GLVHISQIAHE V  V D+L+EG I+ V + 
Sbjct: 617 DVEAGKTYEGKVTRIVDFGAFVEILPGKEGLVHISQIAHERVNKVADHLSEGQIINVKVM 676

Query: 79  GRDAKGRLDLSIKDL 93
             D + R+ LSIK+L
Sbjct: 677 EIDRQNRVRLSIKEL 691


>PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 753

 Score = 70.1 bits (170), Expect = 1e-14
 Identities = 37/76 (48%), Positives = 45/76 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HISQIAHE V  V DYL EG I++V + 
Sbjct: 620 EVEIGKIYEGPVTKILDFGALVNLLPGKDGLLHISQIAHERVERVADYLQEGQIIKVKVM 679

Query: 79  GRDAKGRLDLSIKDLT 94
             D KGR+ LS+K LT
Sbjct: 680 ETDEKGRVKLSLKALT 695


>PNP_VARPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 772

 Score = 69.7 bits (169), Expect = 1e-14
 Identities = 37/76 (48%), Positives = 46/76 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA + L  G+ GL+HISQIAHE V  V DYL+EG IV+V + 
Sbjct: 620 EVEIGKVYEGPVTKILDFGALINLLPGKDGLLHISQIAHERVEKVTDYLSEGQIVKVKVL 679

Query: 79  GRDAKGRLDLSIKDLT 94
             D KGR+ LS+K LT
Sbjct: 680 ETDEKGRVKLSMKALT 695


>PNP_RHOFD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 37/75 (49%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HISQIAHE V  V DYL+EG IV+V + 
Sbjct: 620 EVEIGKIYEGPITKILDFGALVNLLPGKDGLLHISQIAHERVEKVTDYLSEGQIVKVKVM 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDEKGRIKLSMKVL 694


>PNP_HAHCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 37/76 (48%), Positives = 45/76 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQIA E V NV DYL EG  V V + 
Sbjct: 619 EAEVGKLYRGKVERIVEFGAFVNILPGKDGLVHISQIAQERVENVTDYLKEGQEVVVKVL 678

Query: 79  GRDAKGRLDLSIKDLT 94
             DA+GR+ LS+K++T
Sbjct: 679 DIDARGRIKLSMKEVT 694


>PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 68.2 bits (165), Expect = 4e-14
 Identities = 37/75 (49%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HISQIAHE V  V DYL+EG IV+V + 
Sbjct: 620 EVEIGKVYEGAITKILDFGALVNLLPGKDGLLHISQIAHERVEKVTDYLSEGQIVKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDEKGRVKLSMKAL 694


>PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 36/75 (48%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HISQIAHE V  V DYL+EG I++V + 
Sbjct: 620 EVEIGKVYEGAITKILDFGALVNLMPGKDGLLHISQIAHERVEKVTDYLSEGQIIKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDEKGRVKLSMKAL 694


>PNP_COXBU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 35/75 (46%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV++    QGLVHISQIA E V NVRDYL EG +++V + 
Sbjct: 621 EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVI 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K +
Sbjct: 681 EIDRQGRVRLSMKQI 695


>PNP_COXBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 35/75 (46%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV++    QGLVHISQIA E V NVRDYL EG +++V + 
Sbjct: 621 EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVI 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K +
Sbjct: 681 EIDRQGRVRLSMKQI 695


>PNP_COXBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 35/75 (46%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV++    QGLVHISQIA E V NVRDYL EG +++V + 
Sbjct: 621 EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVI 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K +
Sbjct: 681 EIDRQGRVRLSMKQI 695


>PNP_COXB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 35/75 (46%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV++    QGLVHISQIA E V NVRDYL EG +++V + 
Sbjct: 621 EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVI 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K +
Sbjct: 681 EIDRQGRVRLSMKQI 695


>PNP_COXB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 35/75 (46%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV++    QGLVHISQIA E V NVRDYL EG +++V + 
Sbjct: 621 EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVI 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K +
Sbjct: 681 EIDRQGRVRLSMKQI 695


>PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 67.4 bits (163), Expect = 7e-14
 Identities = 35/58 (60%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV    G+ GLVHISQIAHE V NV DYL EG  V V     D +GR+ LSIK+L
Sbjct: 635 FGAFVNFLPGKDGLVHISQIAHERVQNVTDYLKEGQEVDVKCMDIDQRGRIKLSIKEL 692


>PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 35/75 (46%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA + L  G+ GL+HISQIAHE V  V DYL+EG IV+V + 
Sbjct: 620 EIEIGKIYEGPVTKLLDFGALINLLPGKDGLLHISQIAHERVERVSDYLSEGQIVRVKVM 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K L
Sbjct: 680 EADERGRVKLSMKVL 694


>PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 36/75 (48%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V +  G  GL+HISQIAHE V  + DYL EG +V+V I 
Sbjct: 617 EVEVGKVYEGPVIKLLDFGAIVNVLPGRDGLLHISQIAHERVNTIGDYLKEGQVVRVKIL 676

Query: 79  GRDAKGRLDLSIKDL 93
             D KGRL LS+K L
Sbjct: 677 EADEKGRLRLSMKAL 691


>PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 727

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 36/75 (48%), Positives = 44/75 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA + L  G+ GL+HISQIAHE V  V DYL EG IV+V + 
Sbjct: 620 EVEVGKIYEGPVTKILDFGALINLLPGKDGLLHISQIAHERVEKVGDYLQEGQIVKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDDKGRVKLSMKAL 694


>PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 727

 Score = 66.6 bits (161), Expect = 1e-13
 Identities = 35/75 (46%), Positives = 44/75 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA + L  G+ GL+HISQIAHE V  V DYL EG +V+V + 
Sbjct: 620 EVEVGKVYEGPVTKILDFGALINLLPGKDGLLHISQIAHERVEKVGDYLQEGQVVKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDDKGRVKLSMKAL 694


>PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 36/74 (48%), Positives = 46/74 (62%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ELE GT           FGAFV +  G+ GLVHISQI+ E V NV D+L+EG  V+V + 
Sbjct: 620 ELEVGTIYEGKVVRIVDFGAFVNILPGKDGLVHISQISTERVNNVTDHLSEGQEVKVKVL 679

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 680 EVDRQGRVRLSIKE 693


>PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 46/76 (60%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G           +FGAFVE+  G++GL+HIS IAHE V  V D LN GD V+V +
Sbjct: 619 VEPEVGKTYKGKVSRIMNFGAFVEILPGKEGLLHISHIAHERVAKVEDVLNIGDEVEVKV 678

Query: 78  KGRDAKGRLDLSIKDL 93
              D KGR++LS K L
Sbjct: 679 TEIDEKGRVNLSRKVL 694


>PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 33/74 (44%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G +GL+HISQIA E V  V DY+NEG+I++V + 
Sbjct: 620 EAEVGAIYEGKVTRVVDFGAFVAIMPGTEGLLHISQIAEERVEKVTDYVNEGEIIKVKVL 679

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+K+
Sbjct: 680 DVDQRGRIKLSMKE 693


>PNP_CLOPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 65.9 bits (159), Expect = 2e-13
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAF+E A G++G+VHIS+I+ E + +V D L  GD+V+V+  
Sbjct: 620 EFEEGQVFEGKVISIKEFGAFLEFAPGKEGMVHISKISKERINHVEDVLTLGDVVKVVCL 679

Query: 79  GRDAKGRLDLSIKD 92
           G+D  GR+  SIKD
Sbjct: 680 GKDKMGRISFSIKD 693


>PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 65.9 bits (159), Expect = 2e-13
 Identities = 35/75 (46%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+EAG            FGAFV + G ++GLVHISQIA E V  V DYL  G  VQV + 
Sbjct: 617 EVEAGAVYTGKVTRLADFGAFVAILGNKEGLVHISQIAEERVEKVSDYLQVGQDVQVKVV 676

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 677 EIDRQGRIRLTMKDI 691


>PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 758

 Score = 65.9 bits (159), Expect = 2e-13
 Identities = 34/75 (45%), Positives = 44/75 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA + L  G+ GL+HISQIAHE V  V DYL EG +V+V + 
Sbjct: 620 EVEIGKIYEGPVVKILDFGALINLLPGKDGLLHISQIAHERVEKVTDYLTEGQVVKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS++ L
Sbjct: 680 ETDEKGRVKLSMRAL 694


>PNP_SACD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 65.5 bits (158), Expect = 3e-13
 Identities = 33/56 (58%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV    G+ GLVHISQIAHE V NV DYL EG  ++V     D +GR+ LSIK
Sbjct: 647 FGAFVNFLPGKDGLVHISQIAHERVQNVSDYLKEGQDIEVKCMDIDQRGRIKLSIK 702


>PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 35/74 (47%), Positives = 44/74 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E GT           FGAFV +  G+ GLVHISQIA E V NV DYL  G  V+V + 
Sbjct: 617 EVEVGTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+K+
Sbjct: 677 EVDRQGRVRLSMKE 690


>PNP_ALHEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 34/73 (46%), Positives = 44/73 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E GT           FGAFV +  G  GLVHISQI++E V  V DYL EGD V+V + 
Sbjct: 620 DVEVGTVYEGKVSKLMDFGAFVNILPGRDGLVHISQISNERVERVGDYLKEGDTVRVKVL 679

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LS+K
Sbjct: 680 EVDRQGRIRLSMK 692


>PNP_PSYA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 64.3 bits (155), Expect = 6e-13
 Identities = 32/58 (55%), Positives = 41/58 (70%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV +     GLVHISQIA E V NV DYL EG IV+VL++  D +GR+ L++K +
Sbjct: 640 FGAFVNVLPNTDGLVHISQIADERVENVSDYLKEGQIVKVLVQDVDNRGRIKLTMKGI 697


>PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 751

 Score = 64.3 bits (155), Expect = 6e-13
 Identities = 34/75 (45%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HISQIAH+ V  V D+L EG IV+V + 
Sbjct: 620 EAEIGKVYEGPVTKILDFGALVNILPGKDGLLHISQIAHQRVEKVTDFLTEGQIVKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDEKGRIKLSLKAL 694


>PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 64.3 bits (155), Expect = 6e-13
 Identities = 33/56 (58%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV    G+ GLVHISQIA E V NV DYL EG +V+V     D +GR+ LSIK
Sbjct: 635 FGAFVNFLPGKDGLVHISQIADERVNNVSDYLKEGQVVKVKCLDVDQRGRIKLSIK 690


>PNP_PSYCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 31/58 (53%), Positives = 41/58 (70%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAF+ +     GLVHISQIA E V NV DYL EG IV+VL++  D +GR+ L++K +
Sbjct: 640 FGAFINVLPNTDGLVHISQIADERVENVSDYLKEGQIVKVLVQDVDNRGRIKLTMKGI 697


>PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 34/73 (46%), Positives = 44/73 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V +  G+ GL+HISQIA+E V NV D+L EG +V+V + 
Sbjct: 617 EVEVGRVYDGTVLKLLDFGAIVSVLPGKDGLLHISQIANERVNNVGDHLKEGQVVRVKVL 676

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 677 EADDKGRLRLSMK 689


>PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 32/75 (42%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E +TNV D L EG  V+V ++
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERITNVTDVLKEGQEVKVQVQ 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 680 DVDNRGRIKLTMKDI 694


>YABR_BACSU RecName: Full=Uncharacterized protein yabR;
          Length = 128

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 18 VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
          + +E G+          +FGAFVEL GG  GLVHIS++A  YV ++ D+L  GD V+V +
Sbjct: 1  MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKDINDHLKVGDQVEVKV 60

Query: 78 KGRDAKGRLDLSIK 91
             +  G++ LSIK
Sbjct: 61 INVEKDGKIGLSIK 74


>PNP_MARMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLT 94
           FGAFV +  G+ GLVHISQIA E +  V D+L+EG  V V +   DA+GR+ LS+KD+T
Sbjct: 635 FGAFVNILPGKDGLVHISQIAEERIRAVTDFLSEGQEVIVKVLDVDARGRIKLSMKDVT 693


>PNP_PSYWF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 33/73 (45%), Positives = 44/73 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GLVHISQIA E V +V DYL+EG  + VL++
Sbjct: 623 EVEVGKVYKGTVARVVDFGAFVTVLPGTDGLVHISQIADERVESVSDYLSEGQQINVLVQ 682

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ L++K
Sbjct: 683 DVDNRGRIKLTMK 695


>PNP_LEPCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 767

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA + +  G+ GL+HISQIAH+ V  V D+L EG +V+V + 
Sbjct: 620 EAEIGKVYEGPVVKILDFGALINILPGKDGLLHISQIAHQRVEKVTDFLTEGQVVKVKVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS+K L
Sbjct: 680 ETDEKGRIKLSMKAL 694


>PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 34/76 (44%), Positives = 43/76 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV + GG++GLVHISQIA + V  V DYL  G    V + 
Sbjct: 618 EIEVGRIYAGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVADYLQVGQETSVKVL 677

Query: 79  GRDAKGRLDLSIKDLT 94
             D +GR+ LSIK+ T
Sbjct: 678 EIDRQGRVRLSIKEAT 693


>PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 33/75 (44%), Positives = 44/75 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E V NV D L EG  V+V + 
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERVANVSDVLKEGQDVKVQVA 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+KD+
Sbjct: 680 DVDNRGRIKLSMKDI 694


>PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 62.4 bits (150), Expect = 2e-12
 Identities = 34/74 (45%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E GT           FGAFV +  G+ GLVHISQI  E V  V D+L EG  V+V + 
Sbjct: 617 EVEVGTIYTGKVVRLADFGAFVNILPGKDGLVHISQICEERVQKVSDHLKEGQEVKVKVL 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 34/74 (45%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV + 
Sbjct: 619 EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVL 678

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+K+
Sbjct: 679 EIDRQGRVRLSMKE 692


>PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 34/74 (45%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV + 
Sbjct: 619 EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVL 678

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+K+
Sbjct: 679 EIDRQGRVRLSMKE 692


>PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 34/74 (45%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV + 
Sbjct: 619 EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVL 678

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+K+
Sbjct: 679 EIDRQGRVRLSMKE 692


>PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 34/76 (44%), Positives = 43/76 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E              FGAFV + GG++GLVHISQIA + V  V DYL  G  V V + 
Sbjct: 618 EIEVARIYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVADYLQVGQEVSVKVL 677

Query: 79  GRDAKGRLDLSIKDLT 94
             D +GR+ LSIK+ T
Sbjct: 678 EIDRQGRVRLSIKEAT 693


>PNP_PELTS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 734

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGG------EQGLVHISQIAHEYVTNVRDYLNEGDI 72
           E++ G            FG FVE+  G      ++GLVHISQ+AH  V  V D + EGD+
Sbjct: 629 EVQTGEIYTGRVTRITDFGCFVEIIPGVLGMQGKEGLVHISQLAHHRVNRVEDVVKEGDV 688

Query: 73  VQVLIKGRDAKGRLDLSIKDLT 94
           + V + G D++GRL LS K+ T
Sbjct: 689 ILVKVTGYDSQGRLKLSKKEAT 710


>PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+I  + V +V+D + EGDI++V + 
Sbjct: 618 EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D  G++DLS KD
Sbjct: 678 NVDKTGKIDLSRKD 691


>PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+I  + V +V+D + EGDI++V + 
Sbjct: 618 EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D  G++DLS KD
Sbjct: 678 NVDKTGKIDLSRKD 691


>PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+I  + V +V+D + EGDI++V + 
Sbjct: 618 EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D  G++DLS KD
Sbjct: 678 NVDKTGKIDLSRKD 691


>PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+I  + V +V+D + EGDI++V + 
Sbjct: 618 EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D  G++DLS KD
Sbjct: 678 NVDKTGKIDLSRKD 691


>PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E + NV D L EG  V+V ++
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQ 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 680 DVDNRGRIKLTMKDI 694


>PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E + NV D L EG  V+V ++
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQ 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 680 DVDNRGRIKLTMKDI 694


>PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E + NV D L EG  V+V ++
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQ 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 680 DVDNRGRIKLTMKDI 694


>PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E + NV D L EG  V+V ++
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQ 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 680 DVDNRGRIKLTMKDI 694


>PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G  GL+HISQI++E + NV D L EG  V+V ++
Sbjct: 620 EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQ 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++KD+
Sbjct: 680 DVDNRGRIKLTMKDI 694


>PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
           3;         EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase 3;
          Length = 702

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 30/58 (51%), Positives = 42/58 (72%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFVE+  G++GLVHIS +AHE VT V D L EGD+++V +   + +G++ LS K L
Sbjct: 632 FGAFVEILPGKEGLVHISNLAHERVTKVTDVLAEGDLIEVKLMEINPQGKIGLSRKAL 689


>PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+IA+E V  V DY+ EG +V+V + 
Sbjct: 618 EAEVGKIYSGTVLKLLDFGAIVNILPGKDGLLHISEIANERVNQVSDYVKEGQMVRVKLL 677

Query: 79  GRDAKGRLDLSIK 91
             D KGR+ LSIK
Sbjct: 678 STDEKGRMRLSIK 690


>PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 33/75 (44%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQI+ + +  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDQRIEKVTDVLKEGQEVKVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 33/75 (44%), Positives = 44/75 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+EAG            FGAFV + G ++GLVHISQIA E V  V DYL  G  V V + 
Sbjct: 620 EVEAGAVYKGKVTRLADFGAFVSIVGNKEGLVHISQIAEERVEKVSDYLAVGQEVTVKVV 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++K++
Sbjct: 680 EIDRQGRIRLTMKEV 694


>PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 33/73 (45%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V +  G+ GL+HISQIA+E V NV D+L EG  V+V + 
Sbjct: 618 DVEVGRIYEGTVLKLLDFGAIVSVLPGKDGLLHISQIANERVENVADHLKEGQTVRVKVL 677

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 678 EADEKGRLRLSMK 690


>PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 32/59 (54%), Positives = 40/59 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLT 94
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK+ T
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEAT 693


>PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 692

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 33/75 (44%), Positives = 44/75 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G  GLVHIS++A E V +V D +NEGD ++V + 
Sbjct: 616 EVEVGAVYTGKVKTIKDFGAFVEILPGTDGLVHISELALERVKDVTDVVNEGDTIEVKVL 675

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS K L
Sbjct: 676 DVDNRGRIRLSRKAL 690


>PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 33/75 (44%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQI+ + +  V D L EG  V+VL+ 
Sbjct: 620 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDQRIEKVTDVLKEGQEVKVLVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 680 DVDNRGRIKLSIKDV 694


>PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 33/75 (44%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQI+ + +  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 33/75 (44%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQI+ + +  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 33/75 (44%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQI+ + +  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 33/75 (44%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHISQI+ + +  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+I++E V  V+DYL EG +V+V + 
Sbjct: 619 EAEVGKIYEGPVVKLLEFGALVNILPGKDGLLHISEISNERVKEVKDYLAEGQVVRVKLL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GRL LS+K
Sbjct: 679 AADERGRLRLSLK 691


>PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+I++E V  V+DYL EG +V+V + 
Sbjct: 619 EAEVGKIYEGPVVKLLEFGALVNILPGKDGLLHISEISNERVKEVKDYLAEGQVVRVKLL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GRL LS+K
Sbjct: 679 AADERGRLRLSLK 691


>PNP_NITOC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GL+HISQI+ E V NV D L+EGD+++V + 
Sbjct: 618 DVEVGKIYEGRVSRLMDFGAFVTILPGKDGLLHISQISAERVKNVSDKLSEGDVIRVKVL 677

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LS+K
Sbjct: 678 EVDKQGRVRLSVK 690


>PNP_NITEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V +  G+ GL+HISQIA+E V +V D+L EG I++V + 
Sbjct: 618 DVEVGKIYEGTVLKLLDFGAIVSILPGKDGLLHISQIANERVESVADHLKEGQIIRVKVL 677

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 678 EADDKGRLRLSMK 690


>PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 32/59 (54%), Positives = 40/59 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLT 94
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK+ T
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEAT 693


>PNP_AZOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V +  G  GL+H+SQIA+E V NV DY+ EG  V+V + 
Sbjct: 619 EVEVGKVYNGTVVRLLDFGAIVNIMPGRDGLLHVSQIANERVNNVADYVKEGQAVRVKVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +G++ LS+K L
Sbjct: 679 ETDERGKIRLSMKAL 693


>PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 724

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 32/73 (43%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+IA+E V  V DY+ EG  V+V + 
Sbjct: 620 EAEVGKIYNGTVLKLLDFGAIVNILPGKDGLLHISEIANERVNQVSDYVKEGQAVRVKLL 679

Query: 79  GRDAKGRLDLSIK 91
             D KGR+ LSIK
Sbjct: 680 STDEKGRMRLSIK 692


>PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV + G ++GLVHISQIA E V  V DYL  G  V V +   D +GR+ L++KDL
Sbjct: 634 FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEIDRQGRIRLTMKDL 691


>PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV + G ++GLVHISQIA E V  V DYL  G  V V +   D +GR+ L++KDL
Sbjct: 634 FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEIDRQGRIRLTMKDL 691


>PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV + G ++GLVHISQIA E V  V DYL  G  V V +   D +GR+ L++KDL
Sbjct: 634 FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEIDRQGRIRLTMKDL 691


>PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV + G ++GLVHISQIA E V  V DYL  G  V V +   D +GR+ L++KDL
Sbjct: 634 FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEIDRQGRIRLTMKDL 691


>PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V +  G+ GL+HISQIA E V  V DY+ EG IV+V + 
Sbjct: 619 EVEIGKIYEGTVLKILDFGAIVSVLPGKDGLLHISQIAQERVNKVEDYVKEGQIVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LS+K
Sbjct: 679 ETDDRGRVKLSMK 691


>PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 33/76 (43%), Positives = 43/76 (56%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V +
Sbjct: 624 VEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKV 683

Query: 78  KGRDAKGRLDLSIKDL 93
              D KGR+ LS K L
Sbjct: 684 IQTDEKGRVRLSAKAL 699


>PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 33/76 (43%), Positives = 43/76 (56%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V +
Sbjct: 624 VEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKV 683

Query: 78  KGRDAKGRLDLSIKDL 93
              D KGR+ LS K L
Sbjct: 684 IQTDEKGRVRLSAKAL 699


>PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V +  G  GL+H+SQIA+E V NV DY+ EG  V+V + 
Sbjct: 619 EVEVGKVYEGTVVRLLDFGAIVNILPGRDGLLHVSQIANERVNNVGDYVKEGQAVRVKVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +G++ LS+K L
Sbjct: 679 ETDERGKIRLSMKAL 693


>PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 60.5 bits (145), Expect = 9e-12
 Identities = 32/74 (43%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVHISQI  E V +V DYL  GD+V+  + 
Sbjct: 617 DVEIGRIYEGKVTRLAEFGAFVNILPGKDGLVHISQITDERVKDVSDYLKVGDMVRTKVL 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRIRLSIKE 690


>PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 60.5 bits (145), Expect = 9e-12
 Identities = 33/73 (45%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV + GG++GLVHISQIA + V  V DYL  G  V V + 
Sbjct: 618 EVEVGRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVSDYLTMGQEVPVKVL 677

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LS+K
Sbjct: 678 EIDRQGRIRLSMK 690


>PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 60.5 bits (145), Expect = 9e-12
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIA+E + NV DYL EG +V+V     D +GR+ LSIK L
Sbjct: 646 GAIVSILPGKDGLVHISQIANERIKNVSDYLKEGQVVKVKAIEMDDRGRIRLSIKAL 702


>PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 33/72 (45%), Positives = 42/72 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E GT           FGAFV +  G+ GLVHISQI+ E V NV + L EG  V+V + 
Sbjct: 618 EIEVGTLYTGKVVRIVDFGAFVNVLPGKDGLVHISQISEERVNNVSEVLTEGQEVKVKVL 677

Query: 79  GRDAKGRLDLSI 90
             D +GR+ LSI
Sbjct: 678 EVDRQGRVRLSI 689


>PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 35/76 (46%), Positives = 42/76 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV    G  GLVHISQI  E V +VRDYL+EG  V V + 
Sbjct: 619 EPEIGKLYRGTVARITDFGAFVTFMPGTDGLVHISQIVPERVNDVRDYLSEGQEVIVKVL 678

Query: 79  GRDAKGRLDLSIKDLT 94
             D + R+ LSIK++T
Sbjct: 679 DIDNRNRVKLSIKEVT 694


>PNP_BURP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+IA+E + ++ DYL EG  V+V + 
Sbjct: 625 EVEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIANERIKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS K L
Sbjct: 685 QTDEKGRVRLSAKAL 699


>PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV +  G+ GLVHISQI    V NV DYL  GD+V+V +   D +GR+ LSIK
Sbjct: 634 FGAFVNILPGKDGLVHISQITDARVQNVADYLKIGDVVKVKVLEVDRQGRVRLSIK 689


>PNP_ACTPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E              FGAFV + GG++GLVHISQI +E V  V DYL+ G  V V + 
Sbjct: 617 EVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYLSVGQEVTVKVV 676

Query: 79  GRDAKGRLDLSIKDL 93
             D + R+ L++KDL
Sbjct: 677 EIDRQNRIRLTMKDL 691


>PNP_ACTP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E              FGAFV + GG++GLVHISQI +E V  V DYL+ G  V V + 
Sbjct: 617 EVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYLSVGQEVTVKVV 676

Query: 79  GRDAKGRLDLSIKDL 93
             D + R+ L++KDL
Sbjct: 677 EIDRQNRIRLTMKDL 691


>PNP_ACTP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E              FGAFV + GG++GLVHISQI +E V  V DYL+ G  V V + 
Sbjct: 617 EVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYLSVGQEVTVKVV 676

Query: 79  GRDAKGRLDLSIKDL 93
             D + R+ L++KDL
Sbjct: 677 EIDRQNRIRLTMKDL 691


>PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
           1;         EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase 1;
          Length = 702

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 29/58 (50%), Positives = 41/58 (70%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFVE+  G++GLVHIS +AHE V  V D L EGD+++V +   + +G++ LS K L
Sbjct: 632 FGAFVEILPGKEGLVHISNLAHERVAKVADVLAEGDLIEVKLMEINPQGKIGLSRKAL 689


>PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIK 690


>PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ E V  V D L EGD+V+V + 
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 679 EVDKQGRIRLSIK 691


>PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/74 (43%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV + G ++GLVHISQIA E V  V D+L  G  VQV + 
Sbjct: 617 DVEVGRIYTGKVMRIVDFGAFVSVIGAKEGLVHISQIAQERVEKVSDHLQMGQEVQVKVL 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+K+
Sbjct: 677 EIDRQGRIRLSMKE 690


>PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 35/75 (46%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G  GLVHIS++AHE V  V D L  GD V V + 
Sbjct: 620 EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLGDEVTVKVI 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 680 EVDQQGRVNLSRKAL 694


>PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 35/75 (46%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G  GLVHIS++AHE V  V D L  GD V V + 
Sbjct: 620 EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLGDEVTVKVI 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 680 EVDQQGRVNLSRKAL 694


>PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 35/75 (46%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G  GLVHIS++AHE V  V D L  GD V V + 
Sbjct: 620 EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLGDEVTVKVI 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 680 EVDQQGRVNLSRKAL 694


>PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 35/75 (46%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G  GLVHIS++AHE V  V D L  GD V V + 
Sbjct: 620 EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLGDEVTVKVI 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 680 EVDQQGRVNLSRKAL 694


>PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G  GLVHISQI++  V NV D L+EGD V+V + 
Sbjct: 625 DVEVGKVYDGKVAKLMDFGAFVNILPGRDGLVHISQISNNRVENVADELSEGDSVRVKVL 684

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LS+K
Sbjct: 685 EVDRQGRIRLSMK 697


>PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 30/58 (51%), Positives = 40/58 (68%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV + GG++GLVHISQI    V  V DYL+ G  VQV +   + +GR+ L++KDL
Sbjct: 634 FGAFVSILGGKEGLVHISQITDARVERVADYLSVGQDVQVKVVEIERQGRIRLTMKDL 691


>PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK+
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIKE 691


>PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK+
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVAVKVLEVDRQGRVRLSIKE 691


>PNP_ACIF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 692

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 28/58 (48%), Positives = 42/58 (72%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV +  G  GL+HISQI++E V++V D+L EG  V+V +   D +G++ LS+KD+
Sbjct: 633 FGAFVTILPGRDGLLHISQISNERVSDVHDHLKEGQAVRVKVLEVDRQGKIKLSMKDI 690


>PNP_ACIF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 690

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 28/58 (48%), Positives = 42/58 (72%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV +  G  GL+HISQI++E V++V D+L EG  V+V +   D +G++ LS+KD+
Sbjct: 631 FGAFVTILPGRDGLLHISQISNERVSDVHDHLKEGQAVRVKVLEVDRQGKIKLSMKDI 688


>PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 33/72 (45%), Positives = 41/72 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV + 
Sbjct: 619 EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVL 678

Query: 79  GRDAKGRLDLSI 90
             D +GR+ LS+
Sbjct: 679 EIDRQGRVRLSM 690


>PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 33/72 (45%), Positives = 41/72 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV + 
Sbjct: 619 EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVL 678

Query: 79  GRDAKGRLDLSI 90
             D +GR+ LS+
Sbjct: 679 EIDRQGRVRLSM 690


>PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV +   D +GR+ LS+K+
Sbjct: 636 FGAFVTVLPGKDGLVHISQIAEKRVEKVSDYLTEGQEVQVKVLEIDRQGRVRLSMKE 692


>PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 32/75 (42%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++ + V  V D L EG  V+VL+ 
Sbjct: 620 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDQRVEKVTDVLKEGQEVKVLVL 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 680 DVDNRGRIKLSIKDV 694


>PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 35/75 (46%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G  GLVHIS++AHE V  V D L  GD V V + 
Sbjct: 620 EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLGDEVTVKVI 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 680 EVDHQGRVNLSRKAL 694


>PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 35/75 (46%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G  GLVHIS++AHE V  V D L  GD V V + 
Sbjct: 620 EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLGDEVTVKVI 679

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 680 EVDHQGRVNLSRKAL 694


>PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 32/75 (42%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR+ LS K L
Sbjct: 685 QTDEKGRVRLSAKAL 699


>PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 694

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/73 (43%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV    G +GLVH+SQIA E V +V +YL EG  ++V + 
Sbjct: 620 EPEIGKVYDAKVVKIVDFGAFVSYMPGREGLVHVSQIADERVEDVNEYLKEGQEIKVRLT 679

Query: 79  GRDAKGRLDLSIK 91
             D +GR+ LSIK
Sbjct: 680 DVDKQGRVKLSIK 692


>PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/57 (56%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIAHE V NV DYL  G +V V     D +GR+ LSIK L
Sbjct: 638 GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL 694


>PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/57 (56%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIAHE V NV DYL  G +V V     D +GR+ LSIK L
Sbjct: 639 GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL 695


>PNP_NEIMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/57 (56%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIAHE V NV DYL  G +V V     D +GR+ LSIK L
Sbjct: 638 GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL 694


>PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/57 (56%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIAHE V NV DYL  G +V V     D +GR+ LSIK L
Sbjct: 638 GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL 694


>PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/57 (56%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIAHE V NV DYL  G +V V     D +GR+ LSIK L
Sbjct: 638 GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL 694


>PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/57 (56%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GA V +  G+ GLVHISQIAHE V NV DYL  G +V V     D +GR+ LSIK L
Sbjct: 639 GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL 695


>PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+   + NV D L+EG  V V + 
Sbjct: 637 EIEVGAIYKGRVERIVDFGAFVNILPGKDGLVHISQISERRIENVTDELSEGQEVLVKVL 696

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LS+K++
Sbjct: 697 DVDNRGRVKLSMKEV 711


>PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/72 (44%), Positives = 42/72 (58%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            FGA V++  G+ GL+HISQIA+E V  V DYL EG  V+V +  
Sbjct: 625 VEVGKIYEGTVLKLLDFGAIVQVMPGKDGLLHISQIANERVNAVADYLQEGQQVRVKVLE 684

Query: 80  RDAKGRLDLSIK 91
            D +GRL LS+K
Sbjct: 685 TDDRGRLKLSMK 696


>PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 32/72 (44%), Positives = 42/72 (58%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            FGA V++  G+ GL+HISQIA+E V  V DYL EG  V+V +  
Sbjct: 625 VEVGKVYEGTVLKLLDFGAIVQVMPGKDGLLHISQIANERVNAVADYLKEGQQVRVKVLE 684

Query: 80  RDAKGRLDLSIK 91
            D +GRL LS+K
Sbjct: 685 TDDRGRLKLSMK 696


>PNP_GEOSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 34/74 (45%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVHIS++  E V NV D LNEGD V V   
Sbjct: 616 EAEEGKLYMGTVKKVMDFGAFVEIFPGTDGLVHISELDTERVKNVTDVLNEGDKVLVKCI 675

Query: 79  GRDAKGRLDLSIKD 92
           G D +G++ LS K+
Sbjct: 676 GIDKQGKIKLSRKE 689


>PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 638 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 693


>PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIK 690


>PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 762

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFVE+  G++GLVHIS+++ + V  V D +N GD V V +   D  GR++LSIKD
Sbjct: 656 FGAFVEILPGKEGLVHISELSDKRVARVEDVVNIGDEVTVKVTEIDRLGRINLSIKD 712


>PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYIGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 621 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 681 DVDNRGRIKLSIKDV 695


>PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDVLKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L EG  V+VL+ 
Sbjct: 619 EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVL 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ LSIKD+
Sbjct: 679 DVDNRGRIKLSIKDV 693


>PNP_METCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 691

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 30/56 (53%), Positives = 40/56 (71%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV +  G+ GLVHISQI+ E+V  V D L EGD+V+V +   D +GR+ LS+K
Sbjct: 633 FGAFVTILPGKDGLVHISQISDEHVEKVSDKLAEGDMVKVKVLEIDRQGRVRLSMK 688


>PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 29/55 (52%), Positives = 38/55 (69%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GA V++  G  GLVHISQIA+E + NV D+L EG  V+V +   D +GR+ LSIK
Sbjct: 638 GAIVQIMPGRDGLVHISQIANERIANVADHLQEGQQVRVKVLETDERGRIRLSIK 692


>PNP_CAUSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 31/73 (42%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVH+SQI++E V    D L EG IV+V + 
Sbjct: 620 EAEVGAIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQIVKVKLL 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G+  LS+K
Sbjct: 680 GFDDRGKTKLSMK 692


>PNP_BURXL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 30/76 (39%), Positives = 44/76 (57%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +E+E G            FGA V +  G+ GL+HIS+IA+E + ++ DYL +G  V+V +
Sbjct: 624 LEVEVGQVYEGTVLKLLDFGAIVNILPGKDGLLHISEIANERIKDINDYLKDGQQVKVKV 683

Query: 78  KGRDAKGRLDLSIKDL 93
              D KGR+ LS K L
Sbjct: 684 IQTDEKGRVRLSAKAL 699


>PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 30/76 (39%), Positives = 44/76 (57%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +E+E G            FGA V +  G+ GL+HIS+IA+E + ++ DYL +G  V+V +
Sbjct: 624 LEVEVGQVYEGTVLKLLDFGAIVNILPGKDGLLHISEIANERIKDINDYLKDGQQVKVKV 683

Query: 78  KGRDAKGRLDLSIKDL 93
              D KGR+ LS K L
Sbjct: 684 IQTDEKGRVRLSAKAL 699


>PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
           2;         EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase 2;
          Length = 702

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 27/54 (50%), Positives = 39/54 (72%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           FGAFVE+  G++GLVHIS +AHE V  V D L EGD+++V +   + +G++ LS
Sbjct: 632 FGAFVEILPGKEGLVHISNLAHERVAKVADVLAEGDLIEVKLMEINPQGKIGLS 685


>PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLLMGQEVPVKVLEVDRQGRIRLSIK 690


>PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 30/75 (40%), Positives = 45/75 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G           +FGAFVE+  G++GL+HISQ+A E V  V D +  GD V V + 
Sbjct: 614 DVEVGKVYTGKVTRIMNFGAFVEVLPGKEGLIHISQLAEERVAKVEDVVKIGDEVTVKVV 673

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K++
Sbjct: 674 EIDKQGRINLSRKEV 688


>PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G+           FGAF+ ++  ++GLVHISQI ++ V  V DYL+   IV V + 
Sbjct: 618 EIEVGSIYHGKVTRIVDFGAFIAISSNKEGLVHISQITNKRVEKVADYLSIDQIVLVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LS+KD
Sbjct: 678 EVDRQGRIRLSMKD 691


>PNP_BART1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 731

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 31/73 (42%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAF+   G   GLVHISQ+A E VT   D + EGD V V + 
Sbjct: 620 EPEVGAIYQGTVVKTADFGAFINFFGSRDGLVHISQLASERVTKTTDIVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 30/59 (50%), Positives = 39/59 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLT 94
           FGAFV + G ++GLVHISQIA E +  V D+L  G  VQ  +   D +GR+ LSIK+ T
Sbjct: 636 FGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVGQEVQTKVLEIDRQGRIRLSIKEAT 694


>PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 30/56 (53%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LS+K
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVDKVTDYLQMGQEVPVKVIEVDRQGRIRLSMK 690


>PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 30/56 (53%), Positives = 38/56 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LS+K
Sbjct: 635 FGAFVAIGGGKEGLVHISQIADKRVDKVTDYLQMGQEVPVKVIEVDRQGRIRLSMK 690


>PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 23  GTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA 82
           GT           FGAFV +  G+ GLVHISQIA E V NV DYL  G  V+V +   D 
Sbjct: 621 GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLQVGQEVKVKVMEVDR 680

Query: 83  KGRLDLSI 90
           +GR+ LS+
Sbjct: 681 QGRVRLSM 688


>PNP_SHESH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 23  GTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA 82
           GT           FGAFV +  G+ GLVHISQIA E V NV DYL  G  V+V +   D 
Sbjct: 624 GTIYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLQVGQEVKVKVMEVDR 683

Query: 83  KGRLDLSI 90
           +GR+ LS+
Sbjct: 684 QGRVRLSM 691


>PNP_SHEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 23  GTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA 82
           GT           FGAFV +  G+ GLVHISQIA E V NV DYL  G  V+V +   D 
Sbjct: 621 GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVDR 680

Query: 83  KGRLDLSI 90
           +GR+ LS+
Sbjct: 681 QGRVRLSM 688


>PNP_SHEPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 23  GTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA 82
           GT           FGAFV +  G+ GLVHISQIA E V NV DYL  G  V+V +   D 
Sbjct: 624 GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVDR 683

Query: 83  KGRLDLSI 90
           +GR+ LS+
Sbjct: 684 QGRVRLSM 691


>PNP_SHEHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 23  GTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA 82
           GT           FGAFV +  G+ GLVHISQIA E V NV DYL  G  V+V +   D 
Sbjct: 624 GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVDR 683

Query: 83  KGRLDLSI 90
           +GR+ LS+
Sbjct: 684 QGRVRLSM 691


>PNP_METPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 745

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E EAGT           FGAFV   G + GLVHIS++A + V  V D + EG  V+V   
Sbjct: 619 EPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAPQRVAKVGDVVKEGQKVKVKFL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GADERGKIRLSMK 691


>PNP_METEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 745

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E EAGT           FGAFV   G + GLVHIS++A + V  V D + EG  V+V   
Sbjct: 619 EPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAAQRVAKVGDVVKEGQKVKVKFL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GADERGKIRLSMK 691


>PNP_METC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 745

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E EAGT           FGAFV   G + GLVHIS++A + V  V D + EG  V+V   
Sbjct: 619 EPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAAQRVAKVGDVVKEGQKVKVKFL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GADERGKIRLSMK 691


>PNP_IDILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 31/71 (43%), Positives = 41/71 (57%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            FGAFV +  G+ GLVHISQIA E V +V +YL  GD+V V +  
Sbjct: 618 VEVGKIYQGKVARIVDFGAFVTVLPGKDGLVHISQIAEERVNDVNEYLKVGDVVPVKVLE 677

Query: 80  RDAKGRLDLSI 90
            D +GR+ LS+
Sbjct: 678 IDRQGRVRLSM 688


>PNP_HAES2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L G ++GLVHISQIA E V  V DYL  G  V V +   D +GR+ L++K+L
Sbjct: 634 FGAFVALVGNKEGLVHISQIAEERVEKVSDYLAIGQEVIVKVLEIDRQGRIRLTMKEL 691


>PNP_HAES1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L G ++GLVHISQIA E V  V DYL  G  V V +   D +GR+ L++K+L
Sbjct: 634 FGAFVALVGNKEGLVHISQIAEERVEKVSDYLAIGQEVIVKVLEIDRQGRIRLTMKEL 691


>PNP_BIFLO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 913

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVL 76
           EAG           SFGAFV L  G  GL+HISQI +    E +  V D L EGD V+V+
Sbjct: 656 EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLKEGDTVEVI 715

Query: 77  IKGRDAKGRLDLSI 90
           ++G D +G++ L+I
Sbjct: 716 VQGVDDRGKISLAI 729


>PNP_BIFLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 914

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVL 76
           EAG           SFGAFV L  G  GL+HISQI +    E +  V D L EGD V+V+
Sbjct: 656 EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLREGDTVEVI 715

Query: 77  IKGRDAKGRLDLSI 90
           ++G D +G++ L+I
Sbjct: 716 VQGVDDRGKISLAI 729


>PNP_BIFLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 913

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVL 76
           EAG           SFGAFV L  G  GL+HISQI +    E +  V D L EGD V+V+
Sbjct: 656 EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLKEGDTVEVI 715

Query: 77  IKGRDAKGRLDLSI 90
           ++G D +G++ L+I
Sbjct: 716 VQGVDDRGKISLAI 729


>PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 30/57 (52%), Positives = 38/57 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAF  + GG++GLVHISQIA + V  V DYL  G  V V +   D +GR+ LSIK+
Sbjct: 635 FGAFFAIGGGKEGLVHISQIADKRVEKVADYLELGQEVPVKVLEVDRQGRVRLSIKE 691


>PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 725

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+I +E V +++D+L EG  V+V + 
Sbjct: 620 EAEVGKIYAGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEGQQVRVKLI 679

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 680 QADEKGRLRLSLK 692


>PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+I +E V +++D+L EG  V+V + 
Sbjct: 620 EAEVGKIYAGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEGQQVRVKLI 679

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 680 QADEKGRLRLSLK 692


>PNP_GEOLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 33/73 (45%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G  GLVHIS++    V NV D LNEGD V V   
Sbjct: 620 EVEEGKLYMGTVKKIMEFGAFVEVLPGTDGLVHISELDETRVKNVTDILNEGDKVLVKCI 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS K
Sbjct: 680 GVDKQGKIKLSRK 692


>PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 33/74 (44%), Positives = 43/74 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAF++   G++GLVHISQIA   V +VRD L EG  V+V + 
Sbjct: 618 EPEIGRIYDAKVTKITDFGAFLQFLPGKEGLVHISQIADYRVNDVRDELTEGQEVKVKLL 677

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 678 EIDRQGRVRLSIKE 691


>PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+I +E V +++D+L EG  V+V + 
Sbjct: 620 EAEVGKIYAGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEGQQVRVKLI 679

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 680 QADEKGRLRLSLK 692


>PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 892

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVL 76
           EAG           SFGAFV L  G  GL+HISQI +    E +  V D L EGD V+V+
Sbjct: 656 EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLKEGDTVEVV 715

Query: 77  IKGRDAKGRLDLSI 90
           ++G D +G++ L+I
Sbjct: 716 VQGVDDRGKISLAI 729


>PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 32/75 (42%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G           +FGAFVE+  G++GLVHIS +AHE V  V D L  GD + V + 
Sbjct: 617 EPEIGDIFKGKVIKLMNFGAFVEILPGKEGLVHISNLAHERVNKVEDVLAVGDEIDVKVI 676

Query: 79  GRDAKGRLDLSIKDL 93
             D +G++ LS K L
Sbjct: 677 EIDQQGKVSLSRKAL 691


>PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 31/74 (41%), Positives = 42/74 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           + E G            FGAFVE+  G +GL+HISQ+A E V  V D +NEGD V V + 
Sbjct: 626 DAEVGKIYRGTVKKVVDFGAFVEILPGTEGLLHISQLAKERVNKVTDIVNEGDEVIVKVL 685

Query: 79  GRDAKGRLDLSIKD 92
             D +G++ LS K+
Sbjct: 686 EVDKQGKIRLSRKE 699


>PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVAVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVTVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVTVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVTVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVAVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVTVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVAVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 32/74 (43%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRLYTGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLQLNQEVTVKVM 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR+ LSIK+
Sbjct: 677 EVDRQGRVRLSIKE 690


>PNP_MANSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 31/75 (41%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+EAG            FGAFV + G ++GLVHISQIA E V  V DYL           
Sbjct: 617 EVEAGAVYTGKVTRLADFGAFVAIVGNKEGLVHISQIAEERVEKVSDYLXXXXXXXXXXX 676

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L+++DL
Sbjct: 677 XIDRQGRIRLTMRDL 691


>PNP_LEGPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 29/74 (39%), Positives = 39/74 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAF+ L  G+ GL+HISQI  E    V + L EG  ++V + 
Sbjct: 617 EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICAERTQKVEEVLQEGQEIEVFVA 676

Query: 79  GRDAKGRLDLSIKD 92
           G D +GR+ L  KD
Sbjct: 677 GIDKQGRVKLEWKD 690


>PNP_GLOVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 29/55 (52%), Positives = 38/55 (69%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           + GAFVE+  G++GLVHISQ+A   V  V D LN GD V V +K  D KGR++L+
Sbjct: 644 NLGAFVEVMPGKEGLVHISQLAEHRVRKVEDELNVGDEVVVKVKEIDQKGRINLT 698


>PNP_FINM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 31/75 (41%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G           +FGAFVE+  G++GL+HIS IAHE    V D L E D + V + 
Sbjct: 616 EPEIGEKYLGRVTKIMNFGAFVEILPGKEGLLHISNIAHERTNKVEDVLKENDEIMVKLM 675

Query: 79  GRDAKGRLDLSIKDL 93
             D +G++ LS K L
Sbjct: 676 DIDDQGKMTLSRKAL 690


>PNP_CAUCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVH+SQI++E V    D L EG +V+V + 
Sbjct: 620 EAEVGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLL 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G+  LS+K
Sbjct: 680 GFDDRGKTKLSMK 692


>PNP_CAUCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVH+SQI++E V    D L EG +V+V + 
Sbjct: 620 EAEVGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLL 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G+  LS+K
Sbjct: 680 GFDDRGKTKLSMK 692


>PNP_BARBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 733

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 30/73 (41%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E GT           FGAF+   G   GLVHISQ+A + V    D + EGD V V + 
Sbjct: 620 EPEVGTIYQGTVVKTTEFGAFINFFGSHDGLVHISQLASKRVAKTTDVVKEGDKVWVQLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKIRLSMK 692


>PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 30/55 (54%), Positives = 37/55 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSI 90
           FGAFV +  G+ GLVHISQIA + V  V DYL EG  VQV +   D +GR+ LS+
Sbjct: 636 FGAFVTVLPGKDGLVHISQIAEKRVEKVSDYLTEGQEVQVKVLEIDRQGRVRLSM 690


>PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHIS++ +E V  V D + +GD V+V + 
Sbjct: 617 EPEVGEIYEGKVVKIMDFGAFVNFLGSRDGLVHISELKNERVAKVTDVVKQGDAVKVKVL 676

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 677 GFDDRGKVKLSMK 689


>PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 31/73 (42%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVH+SQI++E V  V D L EG  V+V + 
Sbjct: 620 EPEVGQIYTGKVVKIVDFGAFVNFFGAKDGLVHVSQISNERVAKVSDVLTEGQQVKVKLL 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G+  LS+K
Sbjct: 680 GFDDRGKTRLSMK 692


>PNP_HAEDU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV + GG++GLVHISQI    V  V DYL+ G  V V +   D + R+ L++KDL
Sbjct: 634 FGAFVTILGGKEGLVHISQITDARVERVSDYLSVGQEVNVKVVEIDRQNRIRLTMKDL 691


>PNP_GEOUR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 33/74 (44%), Positives = 40/74 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVHIS++  E V NV D L EGD V V   
Sbjct: 615 EAEEGKLYMGLVKKVMEFGAFVEIFPGTDGLVHISELDTERVKNVTDILKEGDKVLVKCI 674

Query: 79  GRDAKGRLDLSIKD 92
           G D +G++ LS K+
Sbjct: 675 GIDKQGKIKLSRKE 688


>PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G+ GLVHIS++A E V  V D ++ GD + V + 
Sbjct: 619 EVEVGQIYLGKVKRIEKFGAFVELFNGKDGLVHISELAEERVGRVEDVVSIGDEILVKVM 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_GEOSF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 33/74 (44%), Positives = 40/74 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVHIS++  E V NV D L EGD V V   
Sbjct: 615 EAEEGKLYMGLVKKVMEFGAFVEIFPGTDGLVHISELDTERVKNVTDVLKEGDKVLVKCI 674

Query: 79  GRDAKGRLDLSIKD 92
           G D +G++ LS K+
Sbjct: 675 GIDKQGKIKLSRKE 688


>PNP_DEIDV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 27/53 (50%), Positives = 38/53 (71%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G+ G++HISQI+ E ++ V D LN GD ++V I G D +G++DL
Sbjct: 638 FGAFVNLYAGQDGMLHISQISEERLSAVEDALNVGDKLRVKIAGIDDRGKIDL 690


>PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++AG           +FGAFVE+   ++GLVHIS++A E V  V D ++ GD + V + 
Sbjct: 617 EVKAGEVYLGKVTKITTFGAFVEILPSKEGLVHISKLAKERVNKVEDVVSIGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR++LS KD
Sbjct: 677 EIDNQGRINLSRKD 690


>PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G+           FGAFV +  G++GLVHISQIAH+ V  V D+L     + V + 
Sbjct: 618 EVEVGSVYTGKVTRIVDFGAFVSIGIGKEGLVHISQIAHKRVDKVSDHLRLHQEIFVKVL 677

Query: 79  GRDAKGRLDLSIK 91
             D +GRL LSIK
Sbjct: 678 EVDRQGRLRLSIK 690


>PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 32/75 (42%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+    QGL+HIS+I++E V  V D L EG+I+ V + 
Sbjct: 621 EAEVGKTYKGRIVKIAEFGAFVEILPNTQGLLHISEISNERVRAVSDVLKEGEIIDVKVL 680

Query: 79  GRDAKGRLDLSIKDL 93
             D  GR+ LS K L
Sbjct: 681 EVDRSGRVKLSRKAL 695


>PNP_BARHE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 733

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+  E VT   D + EGD V V + 
Sbjct: 620 EPEVGVIYQGTVVKTAEFGAFVNFFGSRDGLVHISQLTTERVTKTTDVVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G+ GLVHIS++A E V  V D ++ GD + V + 
Sbjct: 619 EVEVGQVYLGKVKRIEKFGAFVELFSGKDGLVHISELAEERVGKVEDVVSIGDEILVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 31/73 (42%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V   +D + EGD V V + 
Sbjct: 619 EPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 30/56 (53%), Positives = 37/56 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV +  G+ GLVHISQIA + V  V DYL EG  V V +   D +GR+ LS+K
Sbjct: 636 FGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEGQEVPVKVLEIDRQGRVRLSMK 691


>PNP_SINMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V    D + EGD V V + 
Sbjct: 620 EPEVGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_RHISN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V    D + EGD V V + 
Sbjct: 620 EPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_RHIME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V    D + EGD V V + 
Sbjct: 620 EPEVGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V   +D + EGD V V + 
Sbjct: 619 EPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A+E V    D + EGD V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLANERVAKTSDVVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_RHIL3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V   +D + EGD V V + 
Sbjct: 619 EPEIGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V   +D + EGD V V + 
Sbjct: 619 EPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGA V +  G+ GL+HIS+I +E V +++D+L EG  ++V + 
Sbjct: 620 EAEVGKIYNGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEGQQLRVKLI 679

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 680 QADEKGRLRLSLK 692


>PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G+ GLVHIS++A E +  V D ++ GD + V + 
Sbjct: 619 EVEVGQVYLGKVKRIEKFGAFVELFNGKDGLVHISELAEERIGKVEDIVSIGDEILVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_GEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 32/74 (43%), Positives = 40/74 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVH+S++  E V NV D L EGD V V   
Sbjct: 615 EAEEGKLYMGTVKKIMEFGAFVEIFPGTDGLVHVSELDTERVKNVSDILKEGDKVLVKCI 674

Query: 79  GRDAKGRLDLSIKD 92
           G D +G++ LS K+
Sbjct: 675 GIDKQGKIKLSRKE 688


>PNP_GEOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 32/74 (43%), Positives = 40/74 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVH+S++  E V NV D L EGD V V   
Sbjct: 615 EAEEGKLYMGTVKKIMEFGAFVEIFPGTDGLVHVSELDTERVKNVSDILKEGDKVLVKCI 674

Query: 79  GRDAKGRLDLSIKD 92
           G D +G++ LS K+
Sbjct: 675 GIDKQGKIKLSRKE 688


>PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/74 (41%), Positives = 42/74 (56%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            FGAFV L  G+ GL+HISQ+A+E V NV D +  GD V V +  
Sbjct: 623 VEVGQVYLAKVVRIEKFGAFVNLIKGKDGLIHISQLANERVNNVEDVVKLGDEVLVKVTE 682

Query: 80  RDAKGRLDLSIKDL 93
            D +GR+++S K L
Sbjct: 683 IDKQGRVNVSRKAL 696


>PNP_CHLMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           +FGAFVE+  G++GL HIS+++ + V NV D++ EGD + V + 
Sbjct: 617 EVEVGKIYNGRVTSVVAFGAFVEVLPGKEGLCHISELSKQKVDNVADFVKEGDRLAVKLL 676

Query: 79  GRDAKGRLDLSIK 91
             + KG+L LS K
Sbjct: 677 SINEKGQLKLSHK 689


>PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEAKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 43/75 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_AGRT5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V    D + EGD V V + 
Sbjct: 619 EPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTSDVVKEGDKVWVKLM 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_STAS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 41/75 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +GAFVEL  G+  LVHISQIA+E +  V D L  GDI ++ + 
Sbjct: 622 EAEVGQVYEGKVKRIEKYGAFVELFPGKDALVHISQIANERIDKVEDVLKVGDIFKIKVT 681

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++ S K L
Sbjct: 682 EIDKQGRVNASHKAL 696


>PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 686

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 31/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIA--HEYVTNVRDYLNEGDIVQVL 76
           E+EAG           +FGAFVEL  G  GL+HIS++A   + V  V D LNEGD+V+V 
Sbjct: 610 EVEAGDIYVGKVVKTTNFGAFVELTPGRDGLLHISRLAPGKQRVRRVEDVLNEGDVVKVR 669

Query: 77  IKGRDAKGRLDLSI 90
           +   D + R+ L +
Sbjct: 670 VLEIDKQNRISLEM 683


>PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 31/74 (41%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVEL  G  GL+HIS+++ + V +V D LNEGD V V + 
Sbjct: 618 EAEIGKIYTGTVRKIAEFGAFVELFPGTDGLIHISELSDKRVKSVSDVLNEGDEVLVKVV 677

Query: 79  GRDAKGRLDLSIKD 92
             D  G++ LS K+
Sbjct: 678 SIDKTGKIRLSRKE 691


>PNP_LEGPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 28/74 (37%), Positives = 39/74 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAF+ L  G+ GL+HISQI  +    V + L EG  ++V + 
Sbjct: 617 EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICADRTQKVEEVLQEGQEIEVFVA 676

Query: 79  GRDAKGRLDLSIKD 92
           G D +GR+ L  KD
Sbjct: 677 GIDKQGRVKLEWKD 690


>PNP_LEGPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 28/74 (37%), Positives = 39/74 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAF+ L  G+ GL+HISQI  +    V + L EG  ++V + 
Sbjct: 617 EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICADRTQKVEEVLQEGQEIEVFVA 676

Query: 79  GRDAKGRLDLSIKD 92
           G D +GR+ L  KD
Sbjct: 677 GIDKQGRVKLEWKD 690


>PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
           4;         EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase 4;
          Length = 704

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 26/59 (44%), Positives = 40/59 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +FGAF+E+  G++GL+H+S IAHE V  V D L  G  ++V +   D +G+++LS K L
Sbjct: 631 NFGAFLEILPGKEGLLHVSNIAHERVNKVEDVLEVGQEIEVKVMEIDQQGKINLSRKAL 689


>RS1_STAHJ RecName: Full=30S ribosomal protein S1;
          Length = 392

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAHE++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHEHIGTPGEKLEPGQQVNVKILGIDEENERISLSIK 348



 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           L AG           +FGAFV++ GG  GLVH+S+++HE+V +  D ++ G         
Sbjct: 191 LNAGDVIKGKVARLTNFGAFVDI-GGVDGLVHVSELSHEHVDSPEDVVSVGQXXXXXXXX 249

Query: 80  RDAKG-RLDLSIKD 92
                 R+ LSIKD
Sbjct: 250 XXXXAERISLSIKD 263


>PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAF+ +   + GL+HIS+I+HE V  V+D++ EGD + V + G D +GR+ LS K L
Sbjct: 636 FGAFINIMPNQDGLLHISEISHERVEKVKDHIREGDKIDVKVIGLD-RGRIKLSRKVL 692


>PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 771

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG+ GLVH+S+I +E V  V D L+EG  V+V + 
Sbjct: 619 EAEVGKIYDGKVVNLVDFGAFVNFMGGKDGLVHVSEIRNERVEKVADVLSEGQDVKVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             D +G++ LS++
Sbjct: 679 EIDPRGKVRLSMR 691


>PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 28/57 (49%), Positives = 38/57 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAF+ +  G+ GLVHISQI+ E V NV D+L     V+V +   D +GR+ LSIK+
Sbjct: 634 FGAFINILPGKDGLVHISQISDERVANVSDHLEMNQDVKVKVMEVDRQGRVRLSIKE 690


>PNP_RHIEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V    D + EGD V V + 
Sbjct: 619 EPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEGDKVWVKLL 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G+ GLVHIS++A E    V D ++  D + V +K
Sbjct: 619 EVEVGQIYLGKVKRIEKFGAFVELFKGKDGLVHISELAEERTNKVEDVVSIDDQIMVKVK 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDRQGRVNLSRK 691


>PNP_MOOTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 747

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAG------GEQGLVHISQIAHEYVTNVRDYLNEGDI 72
           ++E G            FGAFVE+        G++GLVHISQ+A+E V  V D + EGD 
Sbjct: 634 DVETGKVYNGKVTRVTDFGAFVEVIPRVLGMPGKEGLVHISQLANERVEKVEDVVQEGDY 693

Query: 73  VQVLIKGRDAKGRLDLSIKD 92
           + V   G D +GRL LS K+
Sbjct: 694 ILVKAIGFDPQGRLKLSRKE 713


>PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 29/57 (50%), Positives = 37/57 (64%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFV +  G+ GLVHISQI+ E V NV D+L     V V +   D +GR+ LSIK+
Sbjct: 634 FGAFVNILPGKDGLVHISQISDERVANVSDHLEMNQEVAVKVMEVDRQGRVRLSIKE 690


>PNP_DESHY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 727

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 33/80 (41%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELA------GGEQGLVHISQIAHEYVTNVRDYLNEGDI 72
           E+E G            FGAFVE+        G++GLVHISQ+AH  V  V D +  GD 
Sbjct: 623 EVEVGRIYNGRVTRIMDFGAFVEVIPGVLGLSGKEGLVHISQLAHGRVEKVEDVVKLGDD 682

Query: 73  VQVLIKGRDAKGRLDLSIKD 92
           + V   G D +GRL+LS K+
Sbjct: 683 ILVKATGIDKQGRLNLSRKE 702


>PNP_DESHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 33/80 (41%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELA------GGEQGLVHISQIAHEYVTNVRDYLNEGDI 72
           E+E G            FGAFVE+        G++GLVHISQ+AH  V  V D +  GD 
Sbjct: 623 EVEVGRIYNGRVTRIMDFGAFVEVIPGVLGLSGKEGLVHISQLAHGRVEKVEDVVKLGDE 682

Query: 73  VQVLIKGRDAKGRLDLSIKD 92
           + V   G D +GRL+LS K+
Sbjct: 683 ILVKATGIDKQGRLNLSRKE 702


>PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +++AG           +FGAFVE+   ++GLVHIS++  E V  V D ++ GD + V + 
Sbjct: 617 DVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERVNKVEDVVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKDL 93
             D++GR++LS KD+
Sbjct: 677 EIDSQGRINLSRKDV 691


>PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +++AG           +FGAFVE+   ++GLVHIS++  E V  V D ++ GD + V + 
Sbjct: 617 DVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERVNKVEDVVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKDL 93
             D++GR++LS KD+
Sbjct: 677 EIDSQGRINLSRKDV 691


>PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAF+ +  G++GLVHISQI+++ V  V D+L    I+ V +   D +GRL LSIK++
Sbjct: 635 FGAFISIGIGKEGLVHISQISNKRVEKVSDHLTVDQIISVKVLEIDRQGRLRLSIKEV 692


>PNP_BACSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 30/71 (42%), Positives = 39/71 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GL+HISQIA E +  V D    GD V V + 
Sbjct: 617 EVQVGETYHGKVKRIEKFGAFVELFKGKDGLLHISQIAEERINKVEDVFKLGDEVDVRVT 676

Query: 79  GRDAKGRLDLS 89
             D +GR++LS
Sbjct: 677 EIDNQGRVNLS 687


>PNP_AGRVS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 30/73 (41%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V   +D + EGD V V + 
Sbjct: 619 EPEIGVVYEGTVVKTADFGAFVNFFGSRDGLVHISQLAVDRVAKTQDVVKEGDKVWVKLM 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 679 GFDERGKVRLSMK 691


>PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 32/79 (40%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVEL------AGGEQGLVHISQIAHEYVTNVRDYLNEGDI 72
           E+E G            FGAFVE+        G++GLVHISQ+A E V  VRD ++ GD 
Sbjct: 616 EVEVGKTYMGTVKRIMDFGAFVEIIPGVLGTSGKEGLVHISQLAEERVNKVRDVVDIGDQ 675

Query: 73  VQVLIKGRDAKGRLDLSIK 91
           + V +   D +GR++LS K
Sbjct: 676 ILVKVTEIDRQGRVNLSRK 694


>PNP_LEGPL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/74 (37%), Positives = 38/74 (51%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAF+ L  G+ GL+HISQI       V + L EG  ++V + 
Sbjct: 617 EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICAARTQKVEEVLQEGQEIEVFVA 676

Query: 79  GRDAKGRLDLSIKD 92
           G D +GR+ L  KD
Sbjct: 677 GIDKQGRVKLEWKD 690


>PNP_GEOMG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 32/74 (43%), Positives = 40/74 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVHIS++  E V +V D L EGD V V   
Sbjct: 616 EAEEGKLYMGTVRKVMDFGAFVEIFPGTDGLVHISELDTERVKDVTDILKEGDKVLVKCI 675

Query: 79  GRDAKGRLDLSIKD 92
           G D +G++ LS K+
Sbjct: 676 GIDKQGKIKLSRKE 689


>PNP_CHLPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 694

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 25/57 (43%), Positives = 39/57 (68%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           +FGAFVE+  G++GL HIS+ + + + N+ D + EGDI+ V +   + KG+L LS K
Sbjct: 634 AFGAFVEVLPGKEGLCHISECSRQRIENISDVVKEGDIIDVKLLSINEKGQLKLSHK 690


>PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 623 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 682

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 683 QTDEKGRV 690


>PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 30/74 (40%), Positives = 42/74 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G++GLVHISQI+ + V  V ++L    I+ V + 
Sbjct: 618 EIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVDKVSNHLKIDQIISVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D +GRL LSIK+
Sbjct: 678 EIDRQGRLRLSIKE 691


>PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 30/74 (40%), Positives = 42/74 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G++GLVHISQI+ + V  V ++L    I+ V + 
Sbjct: 618 EIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVDKVSNHLKIDQIISVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D +GRL LSIK+
Sbjct: 678 EIDRQGRLRLSIKE 691


>PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 30/74 (40%), Positives = 42/74 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G++GLVHISQI+ + V  V ++L    I+ V + 
Sbjct: 618 EIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVDKVSNHLKIDQIISVKVL 677

Query: 79  GRDAKGRLDLSIKD 92
             D +GRL LSIK+
Sbjct: 678 EIDRQGRLRLSIKE 691


>PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 54.7 bits (130), Expect = 5e-10
 Identities = 29/56 (51%), Positives = 37/56 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFVEL  G+ GLVHISQ+A E V  V D +  GD + V +   D +GR++LS K
Sbjct: 634 FGAFVELFKGKDGLVHISQLAEERVNKVEDVVKIGDEILVKVMEIDNQGRVNLSRK 689


>PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 748

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG  GLVH+S+I +E V  V D L+EG  V+V + 
Sbjct: 616 EPEVGKIYNGKVVNIVDFGAFVNFMGGRDGLVHVSEIKNERVNKVSDVLSEGQEVKVKVL 675

Query: 79  GRDAKGRLDLSIK 91
             D +G++ LS++
Sbjct: 676 EIDNRGKVRLSMR 688


>PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + G ++GLVHISQIA E +  V D+L  G  V+  +   D +GR+ LSIK
Sbjct: 636 FGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVGQEVKTKVLEIDRQGRIRLSIK 691


>PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV + G ++GLVHISQIA E +  V D+L  G  V+  +   D +GR+ LSIK
Sbjct: 636 FGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVGQEVKTKVLEIDRQGRIRLSIK 691


>PNP_THET8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAF+ L  G +GL+HISQIA   V  V D+L  GD+++V +   D +G++DL
Sbjct: 646 FGAFISLFPGTEGLLHISQIAPGRVARVEDHLKVGDVIKVKVHRIDERGKIDL 698


>PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFVE+A G++GLVHIS+++ + V  V D +  GD + V +   D  GR+ LS KD
Sbjct: 633 FGAFVEIAPGKEGLVHISKLSKKRVQKVEDVVKVGDDILVKVTDIDKLGRISLSRKD 689


>PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFVE+A G++GLVHIS+++ + V  V D +  GD + V +   D  GR+ LS KD
Sbjct: 633 FGAFVEIAPGKEGLVHISKLSKKRVQKVEDVVKVGDDILVKVTDIDKLGRISLSRKD 689


>PNP_SHEB9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 31/72 (43%), Positives = 39/72 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVAVKVM 676

Query: 79  GRDAKGRLDLSI 90
             D +GR+ LSI
Sbjct: 677 EVDRQGRVRLSI 688


>PNP_SHEB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 31/72 (43%), Positives = 39/72 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVAVKVM 676

Query: 79  GRDAKGRLDLSI 90
             D +GR+ LSI
Sbjct: 677 EVDRQGRVRLSI 688


>PNP_SHEB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 31/72 (43%), Positives = 39/72 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +  G+ GLVHISQI+ E V NV D+L     V V + 
Sbjct: 617 EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELNQEVAVKVM 676

Query: 79  GRDAKGRLDLSI 90
             D +GR+ LSI
Sbjct: 677 EVDRQGRVRLSI 688


>PNP_RICBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 744

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/56 (48%), Positives = 37/56 (66%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           GAFV   G + G VHIS+IA E + +V   L +GDIV+V + G D KG+  L+IK+
Sbjct: 637 GAFVNYLGNKDGFVHISEIAEERIESVGSVLKQGDIVKVKLIGFDNKGKAKLTIKN 692


>PNP_RICB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 744

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/56 (48%), Positives = 37/56 (66%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           GAFV   G + G VHIS+IA E + +V   L +GDIV+V + G D KG+  L+IK+
Sbjct: 637 GAFVNYLGNKDGFVHISEIAEERIESVGSVLKQGDIVKVKLIGFDNKGKAKLTIKN 692


>PNP_PELCD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 29/57 (50%), Positives = 37/57 (64%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFVE+  G +GLVHIS++A E V  V D L EGD V V     D +G++ LS K+
Sbjct: 633 FGAFVEIFPGTEGLVHISELAKERVKKVTDILQEGDQVLVKCLDIDRQGKIKLSRKE 689


>PNP_MESSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 31/73 (42%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A E V    D + EGD V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAPERVQKTTDVVKEGDKVFVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           +FGAFVE+  G +GLVHIS++A  +V  V D +  GD + V + 
Sbjct: 624 EVEVGDIYEGRVKKITNFGAFVEILPGREGLVHISELADHHVKKVEDIVKIGDRIPVKVI 683

Query: 79  GRDAKGRLDLSIK 91
             D  GR++LS K
Sbjct: 684 EIDELGRINLSRK 696


>PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/74 (37%), Positives = 44/74 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++EAG           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V + 
Sbjct: 617 DVEAGEIYLGKVTRTTNFGAFVEILPGKEGLVHISKLDFTRVNKVEDVVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKD 92
             D +GR++LS +D
Sbjct: 677 DIDDQGRINLSRRD 690


>PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           +FG FVE+  G++GL HIS+++ + V N+ D++ EGD + V + 
Sbjct: 618 EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLL 677

Query: 79  GRDAKGRLDLSIK 91
             + KG+L LS K
Sbjct: 678 SINEKGQLKLSHK 690


>PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           +FG FVE+  G++GL HIS+++ + V N+ D++ EGD + V + 
Sbjct: 618 EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLL 677

Query: 79  GRDAKGRLDLSIK 91
             + KG+L LS K
Sbjct: 678 SINEKGQLKLSHK 690


>PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           +FG FVE+  G++GL HIS+++ + V N+ D++ EGD + V + 
Sbjct: 618 EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLL 677

Query: 79  GRDAKGRLDLSIK 91
             + KG+L LS K
Sbjct: 678 SINEKGQLKLSHK 690


>PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           +FG FVE+  G++GL HIS+++ + V N+ D++ EGD + V + 
Sbjct: 618 EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLL 677

Query: 79  GRDAKGRLDLSIK 91
             + KG+L LS K
Sbjct: 678 SINEKGQLKLSHK 690


>PNP_BURPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURP0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGA V L  G+ GL+HIS+I +E V ++ DYL EG  V+V + 
Sbjct: 625 EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVI 684

Query: 79  GRDAKGRL 86
             D KGR+
Sbjct: 685 QTDEKGRV 692


>PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 31/75 (41%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD + V + 
Sbjct: 619 EVQVGEIYLGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDEISVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G+ GLVHIS++A E V  V D +  GD + V + 
Sbjct: 619 EVEVGQLYLGKVKRIEKFGAFVEIFSGKDGLVHISELALERVGKVEDVVKIGDEILVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD + V + 
Sbjct: 619 EVEVGQLYLGKVKRIEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDELLVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G+ GLVHIS++A E V  V D +  GD + V + 
Sbjct: 619 EVEVGQLYLGKVKRIEKFGAFVEIFSGKDGLVHISELALERVGKVEDVVKIGDEILVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>RS1_STAAW RecName: Full=30S ribosomal protein S1;
          Length = 391

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAH+++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIK 348



 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FGAF+++ GG  GLVH+S+++HE+V    + ++ G  V+V IK  D    R+ LSIKD
Sbjct: 207 FGAFIDI-GGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKD 263


>RS1_STAAS RecName: Full=30S ribosomal protein S1;
          Length = 391

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAH+++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIK 348



 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FGAF+++ GG  GLVH+S+++HE+V    + ++ G  V+V IK  D    R+ LSIKD
Sbjct: 207 FGAFIDI-GGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKD 263


>RS1_STAAR RecName: Full=30S ribosomal protein S1;
          Length = 391

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAH+++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIK 348



 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FGAF+++ GG  GLVH+S+++HE+V    + ++ G  V+V IK  D    R+ LSIKD
Sbjct: 207 FGAFIDI-GGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKD 263


>RS1_STAAN RecName: Full=30S ribosomal protein S1;
          Length = 391

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAH+++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIK 348



 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FGAF+++ GG  GLVH+S+++HE+V    + ++ G  V+V IK  D    R+ LSIKD
Sbjct: 207 FGAFIDI-GGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKD 263


>RS1_STAAM RecName: Full=30S ribosomal protein S1;
          Length = 391

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAH+++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIK 348



 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FGAF+++ GG  GLVH+S+++HE+V    + ++ G  V+V IK  D    R+ LSIKD
Sbjct: 207 FGAFIDI-GGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKD 263


>RS1_STAAC RecName: Full=30S ribosomal protein S1;
          Length = 391

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A G QGLVHIS+IAH+++    + L  G  V V I G D +  R+ LSIK
Sbjct: 291 NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIK 348



 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FGAF+++ GG  GLVH+S+++HE+V    + ++ G  V+V IK  D    R+ LSIKD
Sbjct: 207 FGAFIDI-GGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKD 263


>PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAF+ L  G +GL+HISQIA   V  V D+L  GD+++V +   D +G++DL
Sbjct: 646 FGAFISLFPGTEGLLHISQIAPGRVERVEDHLKVGDVIKVKVHRIDERGKIDL 698


>PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAF+ L  G +GL+HISQIA   V  V D+L  GD+++V +   D +G++DL
Sbjct: 646 FGAFISLFPGTEGLLHISQIAPGRVERVEDHLKVGDVIKVKVHRIDERGKIDL 698


>PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 774

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG+ GLVH+S+I +E V  V D L+EG  V+V + 
Sbjct: 617 EPEVGKIYTGKVVNLVDFGAFVNFMGGKDGLVHVSEIKNERVEKVADALSEGQEVKVKVL 676

Query: 79  GRDAKGRLDLSIK 91
             D +G++ LS++
Sbjct: 677 EIDNRGKVRLSMR 689


>PNP_RICM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 745

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 29/75 (38%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+I+ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISEERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_RICFE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 747

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 29/75 (38%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+I+ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISEERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_RICAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 747

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/75 (40%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+IA E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVMKVLDSGAFINYLGTKDGFVHISEIAEERIETVGSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVEL  G+ GLVHIS++A   V  V D ++ GD + V + 
Sbjct: 619 EVEVGQVYLGKVKRIEKFGAFVELFNGKDGLVHISELAEGRVGKVEDVVSIGDEILVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 27/71 (38%), Positives = 43/71 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++EAG+          +FGAFVE+  G++G+VHIS++A   V  V D +  GD + V + 
Sbjct: 616 DIEAGSIYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRVEKVEDIVKVGDDITVKVI 675

Query: 79  GRDAKGRLDLS 89
             D +GR++LS
Sbjct: 676 EIDNQGRVNLS 686


>PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 27/71 (38%), Positives = 43/71 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++EAG+          +FGAFVE+  G++G+VHIS++A   V  V D +  GD + V + 
Sbjct: 616 DIEAGSIYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRVEKVEDIVKVGDDITVKVI 675

Query: 79  GRDAKGRLDLS 89
             D +GR++LS
Sbjct: 676 EIDNQGRVNLS 686


>PNP_CLOPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 28/74 (37%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++AG            FGAFVE+   ++GLVHIS++ ++ V  V D ++ GD + V + 
Sbjct: 617 EVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEKVEDVVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKD 92
             D++GR++LS KD
Sbjct: 677 EIDSQGRINLSRKD 690


>PNP_CLOP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 28/74 (37%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++AG            FGAFVE+   ++GLVHIS++ ++ V  V D ++ GD + V + 
Sbjct: 617 EVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEKVEDVVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKD 92
             D++GR++LS KD
Sbjct: 677 EIDSQGRINLSRKD 690


>PNP_CHLFF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 694

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 27/73 (36%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+ + + + NV D++ +GDI+ V + 
Sbjct: 617 EVEVGKIYEGRVTSIVPFGAFVEILPGKEGLCHISEFSKQRIENVGDFVKQGDILPVKLL 676

Query: 79  GRDAKGRLDLSIK 91
             + KG+  LS K
Sbjct: 677 SINEKGQYKLSHK 689


>PNP_CHLCV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 694

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 27/73 (36%), Positives = 42/73 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+ + + + NV D++ +GDI+ V + 
Sbjct: 617 EVEVGKIYEGRVTSIVPFGAFVEILPGKEGLCHISEFSKQRIENVGDFVKQGDILAVKLL 676

Query: 79  GRDAKGRLDLSIK 91
             + KG+  LS K
Sbjct: 677 SINEKGQYKLSHK 689


>PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 719

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V++  G  GL+HIS+IA+  + N+ D L  G  V+V + 
Sbjct: 623 DVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQPVRVKVI 682

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LSIK
Sbjct: 683 EADDKGRLRLSIK 695


>PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 719

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V++  G  GL+HIS+IA+  + N+ D L  G  V+V + 
Sbjct: 623 DVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQPVRVKVI 682

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LSIK
Sbjct: 683 EADDKGRLRLSIK 695


>PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 719

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V++  G  GL+HIS+IA+  + N+ D L  G  V+V + 
Sbjct: 623 DVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQPVRVKVI 682

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LSIK
Sbjct: 683 EADDKGRLRLSIK 695


>PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V++  G  GL+HIS+IA+  + N+ D L  G  V+V + 
Sbjct: 623 DVEVGQVYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQQVRVKVI 682

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 683 EADEKGRLRLSVK 695


>PNP_BIFA0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 873

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVL 76
           +AG           SFGAFV L  G  GL+HISQI +    + +  V D L EGD V+V+
Sbjct: 656 QAGETYKGTVVKTTSFGAFVNLTPGIDGLLHISQIRNLADGQRIDAVEDVLKEGDSVEVV 715

Query: 77  IKGRDAKGRLDLSI 90
           ++G D +G++ L+I
Sbjct: 716 VQGVDDRGKISLAI 729


>PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 733

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 30/73 (41%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+  E VT   + + EGD V V + 
Sbjct: 620 EPEVGGIYQGTVVKTAEFGAFVNFFGSRDGLVHISQLTTERVTKTTNVVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_STAHJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 30/75 (40%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +GAFVEL  G+  L+HISQI+ E +  V D L+ GD + V I 
Sbjct: 622 EAEVGQVYNAKVKRIEKYGAFVELFAGKDALLHISQISKERINKVEDVLSIGDSIDVKIT 681

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++ S K L
Sbjct: 682 EIDKQGRVNASHKAL 696


>PNP_STAES RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 30/75 (40%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +GAFVEL  G+  L+HISQI+ E +  V D L  GD ++V I 
Sbjct: 622 EAEVGQVYHAKVKRIEKYGAFVELFPGKDALLHISQISQERINKVEDVLKIGDTIEVKIT 681

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++ S K L
Sbjct: 682 EIDKQGRVNASHKVL 696


>PNP_STAEQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 30/75 (40%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +GAFVEL  G+  L+HISQI+ E +  V D L  GD ++V I 
Sbjct: 622 EAEVGQVYHAKVKRIEKYGAFVELFPGKDALLHISQISQERINKVEDVLKIGDTIEVKIT 681

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++ S K L
Sbjct: 682 EIDKQGRVNASHKVL 696


>PNP_EXISA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 738

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 28/58 (48%), Positives = 37/58 (63%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFVEL  G+  LVH+S+ + E V NV D +  GD +QV +   D KGR++ S K L
Sbjct: 636 FGAFVELFKGKDALVHVSEFSLERVANVEDVVKLGDSIQVKVTEIDDKGRVNASRKAL 693


>PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 719

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGA V++  G  GL+HIS+IA+  + N+ D L  G  V+V + 
Sbjct: 623 DVEVGQVYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQQVRVKVI 682

Query: 79  GRDAKGRLDLSIK 91
             D KGRL LS+K
Sbjct: 683 EADDKGRLRLSVK 695


>PNP_BLOFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 28/58 (48%), Positives = 37/58 (63%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L  G++GLVHISQI  + V  V DYL  G  V V +   D +GR+ LS++ +
Sbjct: 637 FGAFVTLFAGKEGLVHISQITEKRVNRVSDYLKLGQEVLVKVLEIDRQGRMRLSMRGI 694


>PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 30/75 (40%), Positives = 42/75 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL   + GLVHIS++A E V  V D +  GD++ V + 
Sbjct: 619 EVQVGEIYEGKVKRVEKFGAFVELFSDKDGLVHISELALERVGKVEDVVKIGDVITVKVI 678

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++LS K L
Sbjct: 679 EIDKQGRVNLSRKVL 693


>PNP_RICRS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 748

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+++ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_RICRO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 748

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+++ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_RICPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 748

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+++ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_RICCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 749

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+++ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_RICAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 748

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+++ E +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_PELPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 31/74 (41%), Positives = 39/74 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GLVHIS++  + V  V + LNEGD V V   
Sbjct: 615 EAEEGKLYMGIVKKIMDFGAFVEILPGTDGLVHISELDTKRVKTVTEVLNEGDRVLVKCI 674

Query: 79  GRDAKGRLDLSIKD 92
           G D  G++ LS K+
Sbjct: 675 GVDKNGKVKLSRKE 688


>PNP_DEIRA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 779

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G+ G++HISQ++ + V NV D L  GD ++V I   D +G++DL
Sbjct: 638 FGAFVNLFPGQDGMLHISQLSEQRVENVEDVLTVGDKLKVKIANIDDRGKIDL 690


>PNP_CLOTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 700

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 29/74 (39%), Positives = 42/74 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G           SFGAFVE   G++GLVHIS++  + V  V D +  GD + V + 
Sbjct: 619 DIEPGQVFLGRVIRVTSFGAFVEFLPGKEGLVHISKLDKKRVERVEDIVRVGDQILVKVI 678

Query: 79  GRDAKGRLDLSIKD 92
             D +GR++LS KD
Sbjct: 679 EIDKQGRVNLSRKD 692


>PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 29/71 (40%), Positives = 40/71 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFVEL  G+ GLVHIS++A E V  V D +  GD + V + 
Sbjct: 619 EVQVGEIYLGKVKRIEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIGDEISVKVI 678

Query: 79  GRDAKGRLDLS 89
             D +GR++LS
Sbjct: 679 EIDKQGRVNLS 689


>GS13_BACSU RecName: Full=General stress protein 13;       
          Short=GSP13;
          Length = 130

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 19 ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
          + E G+          ++GAFV L    QGLVHIS++ H +V ++ ++L+ GD VQV + 
Sbjct: 4  KFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVL 63

Query: 79 GRD-AKGRLDLSIK 91
            D  KG++ LSI+
Sbjct: 64 AVDEEKGKISLSIR 77


>RS1_STAS1 RecName: Full=30S ribosomal protein S1;
          Length = 393

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 2/59 (3%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKD 92
           +FGAFV++ GG  GLVH+S+++HE+V +  D ++ G+ V V IK  D    R+ LSIKD
Sbjct: 206 NFGAFVDI-GGVDGLVHVSELSHEHVKSPEDVVSIGETVNVKIKSVDKDSERISLSIKD 263



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+  G QGLV              + L  G +V V + G D +  R+ LSIK
Sbjct: 291 NFGAFVEIKPGVQGLVXXXXXXXXXXXXXXEALEPGQVVSVKVLGVDVENERISLSIK 348


>RS1H_BACC1 RecName: Full=30S ribosomal protein S1 homolog;
          Length = 382

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LI 77
           E++AG           +FGAFVE+  G +GLVH+SQIA+ +V N  + L  G  V+V ++
Sbjct: 270 EVKAGDIREGIVKRLVTFGAFVEILPGVEGLVHVSQIANRHVKNPNEVLEMGQEVKVKVL 329

Query: 78  KGRDAKGRLDLSIKD 92
           +   A+ R+ LSIK+
Sbjct: 330 EVHVAEKRISLSIKE 344



 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIK 91
           FGAFV + GG  GLVHISQI+HE V    + L +G  V+V +   DA   R+ LSIK
Sbjct: 202 FGAFVNV-GGVDGLVHISQISHERVEQPSEVLEQGQKVKVKVLSVDADTQRISLSIK 257


>PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAF+ +   + GL+HIS+IAHE V  V ++L EGD + V +   D +GR+ LS K L
Sbjct: 636 FGAFINIKPNQDGLLHISEIAHERVDKVENHLKEGDEIDVKVLSLD-RGRIKLSRKVL 692


>PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 773

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 28/59 (47%), Positives = 37/59 (62%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           SFGAFV L G +  +VHIS++A     NV D +  GD V+V I   D KGR+D S++ L
Sbjct: 638 SFGAFVNLFGKQDAMVHISEMAWARTENVEDVVKLGDTVKVKIMKIDDKGRVDASMRAL 696


>PNP_HAMD5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 30/73 (41%), Positives = 39/73 (53%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            +GAFV +A  ++GLVHISQIA   V  V D+L     V V +  
Sbjct: 619 IEVGRIYQGTVTRIADYGAFVSIASAKEGLVHISQIAEGRVEKVTDHLKLKQQVSVKVLE 678

Query: 80  RDAKGRLDLSIKD 92
            D +GR+ LSIKD
Sbjct: 679 IDRQGRIRLSIKD 691


>PNP_CLOPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 27/74 (36%), Positives = 45/74 (60%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+++G            FGAFVE+   ++GLVHIS++ ++ V  V D ++ GD + V + 
Sbjct: 617 EVKSGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEKVEDIVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKD 92
             D++GR++LS KD
Sbjct: 677 EIDSQGRINLSRKD 690


>PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 28/74 (37%), Positives = 44/74 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G           +FGAFVE+  G++GLVHIS++  + V  V D ++ GD + V + 
Sbjct: 617 EVKEGEVYLGKVTKIANFGAFVEILPGKEGLVHISKLDVKRVNKVEDVVSVGDEILVKVT 676

Query: 79  GRDAKGRLDLSIKD 92
             D+ GR++LS KD
Sbjct: 677 EIDSMGRVNLSRKD 690


>PNP_ANASK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 28/74 (37%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GL+HIS+++ + V +V D L+EG+ V V + 
Sbjct: 627 EAEVGRIYLGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRVKSVSDVLSEGEEVMVKVI 686

Query: 79  GRDAKGRLDLSIKD 92
             D  G++ LS K+
Sbjct: 687 SVDRSGKIRLSRKE 700


>PNP_ANADE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 28/74 (37%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GL+HIS+++ + V +V D L+EG+ V V + 
Sbjct: 627 EAEVGRIYMGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRVKSVSDVLSEGEEVMVKVI 686

Query: 79  GRDAKGRLDLSIKD 92
             D  G++ LS K+
Sbjct: 687 SVDRSGKIRLSRKE 700


>PNP_ANAD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 28/74 (37%), Positives = 41/74 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G  GL+HIS+++ + V +V D L+EG+ V V + 
Sbjct: 627 EAEVGRIYLGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRVKSVSDVLSEGEEVMVKVI 686

Query: 79  GRDAKGRLDLSIKD 92
             D  G++ LS K+
Sbjct: 687 SVDRSGKIRLSRKE 700


>PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 28/71 (39%), Positives = 41/71 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +L AG             GAFVEL  G++G++HISQ+A   V  V D +  GD + V I+
Sbjct: 627 KLNAGDVYLGRVTRIIPIGAFVELLPGKEGMIHISQLAEYRVGKVEDEVKIGDEIVVKIR 686

Query: 79  GRDAKGRLDLS 89
             D+KGR++L+
Sbjct: 687 EVDSKGRINLT 697


>PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GAFVE   G++G++HISQIA   V  V D L  GD V V ++  D KGR++L+ K +
Sbjct: 645 GAFVEFLPGKEGMIHISQIADYRVARVEDELTVGDEVVVKVREIDQKGRVNLTRKGI 701


>PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           GAFVE   G++G++HISQIA   V  V D L  GD V V ++  D KGR++L+ K +
Sbjct: 645 GAFVEFLPGKEGMIHISQIADYRVARVEDELTVGDEVVVKVREIDQKGRVNLTRKGI 701


>PNP_STACT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +G FVEL  G+  L+HISQIA++ +  V D L  GD ++V + 
Sbjct: 622 EAEVGQVYNAKVRRIEKYGTFVELFPGKDALLHISQIANQRINKVEDVLKLGDTIEVKVT 681

Query: 79  GRDAKGRLDLSIKDL 93
             D KGR++ S + L
Sbjct: 682 EIDDKGRVNASHRAL 696


>PNP_GEMAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 732

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +FGAFVE+  G + L+H+S++  E V    D + +GD V V +  RD +GRL LS+K L
Sbjct: 631 AFGAFVEIMPGNEALLHVSEMRWERVEKPEDVVKKGDRVTVKLVDRDERGRLRLSMKAL 689


>PNP_ELUMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 28/58 (48%), Positives = 37/58 (63%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFVEL  G+ GL+HIS+I  + +  V D L  GDIV+V +   D  G++ LS K L
Sbjct: 640 FGAFVELIPGKDGLLHISEIDKKRINKVEDVLKMGDIVEVKVVEIDNNGKVRLSRKVL 697


>ISPH_CLOTE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
           reductase;         EC=1.17.1.2;
          Length = 635

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 1/60 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKDL 93
           SFGAFVEL  G  GL+HISQI+H+ V  V D L+ G+ V+  I   D  K ++ LSIK++
Sbjct: 573 SFGAFVELEPGVDGLIHISQISHKRVDRVEDELSIGEQVKAKIVEVDGEKRKIGLSIKEV 632


>RS1_LEULA RecName: Full=40S ribosomal protein S1;
          Length = 429

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LI 77
           ++ AG+           FGAFVE+  G +GLVH+SQI+++ + N  + L  GD VQV ++
Sbjct: 312 QIAAGSVLEGTVKRVKDFGAFVEILPGIEGLVHVSQISNKRIENPSEVLKSGDKVQVKVL 371

Query: 78  KGRDAKGRLDLSIKDL 93
             + A+ R+ LS+K L
Sbjct: 372 DIKPAEERISLSMKAL 387



 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 51  HISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIK 91
           H+S+I+H+ V N  D L +GD V V I   D  KGR+ LSIK
Sbjct: 258 HVSEISHDRVKNPADVLTKGDKVDVKILALDTEKGRISLSIK 299


>PNP_SULAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 24/76 (31%), Positives = 44/76 (57%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +++E G            +GAFVEL  G   L+H+SQI  E + + ++ +  GD+++V +
Sbjct: 617 LDVEVGEVYMGKVTRVEDYGAFVELLPGRLSLLHVSQITGERLKSAKEKIKVGDVLKVKV 676

Query: 78  KGRDAKGRLDLSIKDL 93
              D +GR+ +S+KD+
Sbjct: 677 SEIDDQGRIKVSLKDV 692


>PNP_STRTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 741

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A ++  +V D +  GD+V V I   D KGR+D SIK L
Sbjct: 638 FGAFVHLFNKTDALVHISELAWKHTEHVEDVVKVGDMVTVKIIKIDEKGRVDASIKTL 695


>PNP_STRT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 741

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A ++  +V D +  GD+V V I   D KGR+D SIK L
Sbjct: 638 FGAFVHLFNKTDALVHISELAWKHTEHVEDVVKVGDMVTVKIIKIDEKGRVDASIKTL 695


>PNP_STRT1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 741

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A ++  +V D +  GD+V V I   D KGR+D SIK L
Sbjct: 638 FGAFVHLFNKTDALVHISELAWKHTEHVEDVVKVGDMVTVKIIKIDEKGRVDASIKTL 695


>PNP_RICCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 747

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           GAF+   G + G VHIS+I+ E +  V   + +GDIV+V + G D KG+  L+IK+
Sbjct: 637 GAFINYLGNKDGFVHISEISEERIDTVSSVIKQGDIVKVKLIGFDNKGKAKLTIKN 692


>PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQIA++ +T+  + L EG  V+V + 
Sbjct: 621 EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ L +K
Sbjct: 681 GFDERGKVRLGMK 693


>PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQIA++ +T+  + L EG  V+V + 
Sbjct: 621 EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ L +K
Sbjct: 681 GFDERGKVRLGMK 693


>PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQIA++ +T+  + L EG  V+V + 
Sbjct: 621 EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ L +K
Sbjct: 681 GFDERGKVRLGMK 693


>PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQIA++ +T+  + L EG  V+V + 
Sbjct: 621 EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ L +K
Sbjct: 681 GFDERGKVRLGMK 693


>PNP_OCHA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLASDRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV   G + GLVHISQ+A   V    D + EGD V+V + G D +G+  LS+K
Sbjct: 636 FGAFVNFFGAKDGLVHISQLAANRVQKSSDIVKEGDKVKVKLLGFDDRGKTRLSMK 691


>PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 26/59 (44%), Positives = 40/59 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS KD+
Sbjct: 633 NFGAFVEVLPGKEGLVHISKLDINKVNKVEDVVSVGDEILVKVTDIDNQGRVNLSRKDV 691


>PNP_CHLAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 694

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 26/73 (35%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS+ + + + NV D++ +GD + V + 
Sbjct: 617 EVEVGKIYEGRVTSVVPFGAFVEILPGKEGLCHISEFSKQRIDNVGDFVKQGDTLTVKLL 676

Query: 79  GRDAKGRLDLSIK 91
             + KG+  LS K
Sbjct: 677 SINEKGQYKLSHK 689


>IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 275

 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 26/63 (41%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 35 SFGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          ++GAF++L    G++G +HIS++A  +V N+RDYL EG  +V  +I+    KG +DLS++
Sbjct: 24 NYGAFLDLDEYPGKEGFMHISEVASTWVKNIRDYLREGQKVVAKVIRVDPKKGHIDLSLR 83

Query: 92 DLT 94
           +T
Sbjct: 84 RVT 86


>PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 28/58 (48%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A     NV D +  GD V V++   DAKGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISELAWTRTNNVEDVVQIGDEVDVMVIKIDAKGRVDASMKAL 695


>PNP_RICTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 745

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 28/75 (37%), Positives = 39/75 (52%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+I+   +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISETRIDKVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_DEIGD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 25/53 (47%), Positives = 35/53 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G+ G++HISQ++   V  V D LN GD ++V I   D +G++DL
Sbjct: 638 FGAFVNLFPGQDGMLHISQMSENRVNAVEDVLNVGDRLRVKIANIDDRGKIDL 690


>PNP_BRUSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUSI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUO2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_BRUA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 29/73 (39%), Positives = 37/73 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A + V    D + EG  V V + 
Sbjct: 620 EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_RICPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 745

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 28/75 (37%), Positives = 39/75 (52%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G             GAF+   G + G VHIS+I+   +  V   L +GDIV+V +
Sbjct: 618 VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISDARIDKVSSVLKQGDIVKVKL 677

Query: 78  KGRDAKGRLDLSIKD 92
            G D KG+  L+IK+
Sbjct: 678 IGFDNKGKAKLTIKN 692


>PNP_NATTJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 28/73 (38%), Positives = 39/73 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +GAFVE+  G++GLVHIS++A + V    D    GD + V I 
Sbjct: 625 EPEVGEVYLGKVVRTEKYGAFVEILPGKEGLVHISELAEDRVGKTEDVAKVGDEILVKII 684

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 685 NIDERGRINLSRK 697


>PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 26/73 (35%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FG FV   G + GLVH+SQ+A++ + + ++ + EGD V V + 
Sbjct: 620 EAEVGEIYEGKVVSMKDFGIFVNFFGPKDGLVHVSQMANKRIGHPKEMVKEGDKVWVKLM 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDERGKVRLSMK 692


>PNP_GLUOX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 27/73 (36%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHIS++A   V    D + +GD V+V + 
Sbjct: 617 EPEIGRIYEGKVVKTADFGAFVNFLGPRDGLVHISELAEGRVAKTSDVVKQGDAVKVKVI 676

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS++
Sbjct: 677 GFDDRGKVKLSMR 689


>PNP_DESRM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 740

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGG------EQGLVHISQIAHEYVTNVRDYLNEGDI 72
           E++ G            FG FVE+  G      ++GLVHISQ+A + V    D + EG++
Sbjct: 628 EVQVGKLYNGKVTRVTDFGCFVEVIPGVMGLPGKEGLVHISQLAFQRVEKTEDIVKEGEV 687

Query: 73  VQVLIKGRDAKGRLDLSIKD 92
           + V   G D +GRL LS K+
Sbjct: 688 IAVKAIGYDQQGRLKLSKKE 707


>PNP_CYAP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE+  G++G++HISQ+A   V  V D +  GD V V ++  DAKGRL+L+
Sbjct: 647 GAFVEVLPGKEGMIHISQLAEGRVGKVEDEVAVGDEVIVKVREIDAKGRLNLT 699


>PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS KD
Sbjct: 633 NFGAFVEIHKGKEGLVHISKLDFTRVNKVEDIVSVGDEILVKVIEIDNQGRINLSRKD 690


>PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS KD
Sbjct: 633 NFGAFVEIHKGKEGLVHISKLDFTRVNKVEDIVSVGDEILVKVIEIDNQGRINLSRKD 690


>PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 28/73 (38%), Positives = 41/73 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAF+E+  G+ GLVHIS++A + V  V D +  GD + V + 
Sbjct: 619 EVEVGQLYLGKVKRIEKFGAFLEIFSGKDGLVHISELALDRVGKVEDVVKIGDELLVKVT 678

Query: 79  GRDAKGRLDLSIK 91
             D +GR++LS K
Sbjct: 679 EIDKQGRVNLSRK 691


>PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 50.8 bits (120), Expect = 7e-09
 Identities = 27/53 (50%), Positives = 37/53 (69%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE+  G++G+VHISQIA   V  V D L  GD V V ++  D+KGR++L+
Sbjct: 646 GAFVEVFAGKEGMVHISQIADYRVGKVEDELAIGDEVIVKVREIDSKGRVNLT 698


>PNP_PELUB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 690

 Score = 50.8 bits (120), Expect = 7e-09
 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 1/56 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV   G + GLVHIS++A + V  V D + EGD V+V + G D +G++ LS+K
Sbjct: 632 FGAFVNFLGKQDGLVHISELATKRVEKVTDIVKEGDEVKVKVIGFD-RGKVKLSMK 686


>PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 769

 Score = 50.8 bits (120), Expect = 7e-09
 Identities = 26/73 (35%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG+ GLVH+S++ +E V    D ++EG  V+V + 
Sbjct: 623 EAEVGKIYNGKVVNIVDFGAFVNFMGGKDGLVHVSEMKNERVEKPTDVVSEGQEVKVKVL 682

Query: 79  GRDAKGRLDLSIK 91
             D +G++ LS++
Sbjct: 683 EIDQRGKVRLSMR 695


>PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 50.8 bits (120), Expect = 7e-09
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE+  G++G++HISQ+A   V  V D L  GD V V ++  D KGRL+L+
Sbjct: 647 GAFVEIMPGKEGMIHISQLAEGRVGKVEDELAVGDEVVVKVREIDNKGRLNLT 699


>IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 275

 Score = 50.8 bits (120), Expect = 7e-09
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 3/63 (4%)

Query: 35 SFGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          ++GAF+EL    G++  +HIS++A  +V N+RDYL EG  +V  +I+    KG +DLS++
Sbjct: 24 NYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLR 83

Query: 92 DLT 94
           +T
Sbjct: 84 RVT 86


>IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 275

 Score = 50.8 bits (120), Expect = 7e-09
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 3/63 (4%)

Query: 35 SFGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          ++GAF+EL    G++  +HIS++A  +V N+RDYL EG  +V  +I+    KG +DLS++
Sbjct: 24 NYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVDPRKGHIDLSLR 83

Query: 92 DLT 94
           +T
Sbjct: 84 RVT 86


>RR1_SPIOL RecName: Full=30S ribosomal protein S1,
           chloroplastic;AltName: Full=CS1;Flags: Precursor;
          Length = 411

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRD-AKGRLDLSIKDL 93
           +GAF+++ GG  GL+H+SQI+H+ V+++   L  GD ++V+I   D  +GR+ LS K L
Sbjct: 274 YGAFIDI-GGINGLLHVSQISHDRVSDIATVLQPGDTLKVMILSHDRERGRVSLSTKKL 331


>PNP_THISH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 28/75 (37%), Positives = 38/75 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G  GLVHISQI+ E V +V D L EG        
Sbjct: 618 DVEVGRIYEGRVVKIMDFGAFVTILPGRDGLVHISQISEERVESVSDRLTEGXXXXXXXX 677

Query: 79  GRDAKGRLDLSIKDL 93
               +GR+ LS+K++
Sbjct: 678 XXXXQGRIRLSMKEV 692


>PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 629 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 686


>PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA    TNV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 28/73 (38%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQI +  + +  D L EG  V+V + 
Sbjct: 621 EPEEGAVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 681 GFDDRGKVRLSMK 693


>PNP_MICAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 25/53 (47%), Positives = 37/53 (69%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE+  G++G++HISQ+A   V  V D +  GD V V ++  D+KGRL+L+
Sbjct: 646 GAFVEVLPGKEGMIHISQLAEGRVGKVEDEVAVGDEVLVKVREIDSKGRLNLT 698


>PNP_LEPBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 27/75 (36%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS++  + V +VRD ++EG        
Sbjct: 618 EIEVGKIYDGVIKRIADFGAFVEILPGKEGLCHISKLDVKRVQSVRDIVSEGXXXXXXXX 677

Query: 79  GRDAKGRLDLSIKDL 93
                G++DLS KD+
Sbjct: 678 XXXXMGKIDLSRKDV 692


>PNP_LEPBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 696

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 27/75 (36%), Positives = 40/75 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFVE+  G++GL HIS++  + V +VRD ++EG        
Sbjct: 618 EIEVGKIYDGVIKRIADFGAFVEILPGKEGLCHISKLDVKRVQSVRDIVSEGXXXXXXXX 677

Query: 79  GRDAKGRLDLSIKDL 93
                G++DLS KD+
Sbjct: 678 XXXXMGKIDLSRKDV 692


>PNP_DESAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 741

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGG------EQGLVHISQIAHEYVTNVRDYLNEGDI 72
           E++ G            FG FVE+  G      + GLVHIS +AH  V  V D + EGD 
Sbjct: 628 EVKVGEVYLGRVVKIMDFGCFVEVIPGVLGLPGKDGLVHISHLAHNRVRKVEDVVREGDQ 687

Query: 73  VQVLIKGRDAKGRLDLSIKD 92
           + V   G D +GRL LS K+
Sbjct: 688 ILVKAIGFDNQGRLKLSKKE 707


>PNP_ANADF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 722

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 28/71 (39%), Positives = 39/71 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVEL  G  GL+HIS+++ + V +V D L+EG+ V V + 
Sbjct: 627 EAEIGKTYLGTVRKIAEFGAFVELFPGTDGLIHISELSDKRVKSVSDVLSEGEEVLVKVI 686

Query: 79  GRDAKGRLDLS 89
             D  G++ LS
Sbjct: 687 SVDRAGKIRLS 697


>RS1_STAEQ RecName: Full=30S ribosomal protein S1;
          Length = 392

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 28/58 (48%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           +FGAFVE+A   QGLVHIS+I H+++ +  + L  G  V V I G D    R+ LSIK
Sbjct: 291 NFGAFVEIAPSVQGLVHISEIDHKHIGSPNEVLEPGQQVNVKILGIDEDNERISLSIK 348



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 14/26 (53%), Positives = 23/26 (88%), Gaps = 1/26 (3%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYV 60
           +FGAF+++ GG  GLVH+S+++HE+V
Sbjct: 206 NFGAFIDI-GGVDGLVHVSELSHEHV 230


>PNP_TREDE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 26/57 (45%), Positives = 35/57 (61%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           FGAFVE+  G++GL HIS+++   V  V D L EG  + V +   D  GRL+LS  D
Sbjct: 635 FGAFVEILPGKEGLCHISKLSRSRVEKVSDVLKEGQEIPVKLLEIDKLGRLNLSYVD 691


>PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 29/73 (39%), Positives = 36/73 (49%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAF E+    +GL+HISQ+ H  V  V D + EGD V V + 
Sbjct: 616 EPEVGQLYMSRIVRVTDFGAFAEILPNIEGLIHISQLEHRRVRKVTDVVQEGDEVLVKVI 675

Query: 79  GRDAKGRLDLSIK 91
             D  GR+ LS K
Sbjct: 676 EIDKDGRIRLSRK 688


>PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 28/73 (38%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQI +  + +  D L EG  V+V + 
Sbjct: 621 EPEEGQVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 681 GFDDRGKVRLSMK 693


>PNP_SALRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFVE+   + GL+H+S+I ++YV NV DYL  GD V+V +      G++ L+ K
Sbjct: 645 FGAFVEIMPEKTGLLHVSEIDYDYVENVEDYLEVGDKVKVHLLEVHDDGKMRLTRK 700


>PNP_ROSDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 28/73 (38%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQI +  + +  D L EG  V+V + 
Sbjct: 621 EPEEGMVYTGTVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLL 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 681 GFDDRGKVRLSMK 693


>PNP_DINSH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 28/73 (38%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQI +  + +  D L EG  V+V + 
Sbjct: 622 EPEEGKVYTGTVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLL 681

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 682 GFDDRGKVRLSMK 694


>PNP_CYAP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 26/71 (36%), Positives = 40/71 (56%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +L AG             GAFVE   G++G++HISQ+A   V  V D ++ GD V V ++
Sbjct: 627 KLSAGDVYVGKVTRIIPIGAFVEFLPGKEGMIHISQLADYRVNKVEDEVSVGDEVIVKVR 686

Query: 79  GRDAKGRLDLS 89
             D +GR++L+
Sbjct: 687 EIDGRGRINLT 697


>PNP_AKKM8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 25/71 (35%), Positives = 38/71 (53%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G           +FGAF+E+  G+ GL+HIS++A        D ++ GD+V     G
Sbjct: 625 IEIGELYTGKIVSTTTFGAFMEVLPGKDGLIHISELAEGRTAKTEDVVSVGDVVTAKCIG 684

Query: 80  RDAKGRLDLSI 90
            D KGR+ +SI
Sbjct: 685 IDDKGRVKMSI 695


>IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 275

 Score = 50.1 bits (118), Expect = 1e-08
 Identities = 27/59 (45%), Positives = 40/59 (67%), Gaps = 3/59 (5%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          +GAF+ L    G++G +HIS++A  +V N+RDYL EG  IV  +I+    KG +DLS+K
Sbjct: 25 YGAFLTLDEYPGKEGFMHISEVAPTWVKNIRDYLKEGQKIVAKVIRVDPEKGHIDLSLK 83


>RS1H_BACSU RecName: Full=30S ribosomal protein S1 homolog;
          Length = 382

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 25/60 (41%), Positives = 42/60 (70%), Gaps = 1/60 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           SFGAFVE+  G +GLVHISQI+++++    + L EG  V+V ++   + + R+ LS+++L
Sbjct: 285 SFGAFVEILPGVEGLVHISQISNKHIGTPHEVLEEGQTVKVKVLDVNENEERISLSMREL 344



 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           LE G+           FGAFV++ GG  GLVHISQ++H +V    D              
Sbjct: 185 LEVGSVLDGKVQRLTDFGAFVDI-GGIDGLVHISQLSHSHVEKPSDXXXXXXXXXXXXLS 243

Query: 80  RDAKG-RLDLSIKD 92
            D    R+ LSIKD
Sbjct: 244 VDRDNERISLSIKD 257


>PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 733

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 28/58 (48%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A     NV D +  GD V V +   DAKGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISELAWTRTNNVEDVVQIGDEVDVKVIKIDAKGRVDASMKVL 695


>PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 772

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 26/73 (35%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG+ GLVH+S++ +E V    D + EG  V V + 
Sbjct: 618 EAEVGKIYKGKVVNIVDFGAFVNFMGGKDGLVHVSEMKNERVEKPTDVVKEGQDVYVKVL 677

Query: 79  GRDAKGRLDLSIK 91
             D +G++ LS++
Sbjct: 678 EIDQRGKVRLSMR 690


>PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 28/73 (38%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVH+SQ+  E V +  D + EG  V V + 
Sbjct: 620 EPEEGQIYKGKVVKVMDFGAFVNFFGPKDGLVHVSQLKAERVNHPSDVVKEGQEVYVKLL 679

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS+K
Sbjct: 680 GFDDRGKVRLSMK 692


>PNP_MACCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 30/75 (40%), Positives = 38/75 (50%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G+  LVHISQIA E +  V D +  GD   V + 
Sbjct: 618 EAEVGQIYMATVKRIEKFGAFVEIFPGKDALVHISQIALERINKVEDVVKLGDQFLVKVT 677

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR++ S K L
Sbjct: 678 EIDKQGRVNASRKVL 692


>PNP_JANSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 706

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV   G   GLVH+SQI +E + +  D L+EG  V V + G D +G++ L++K
Sbjct: 638 FGAFVNFFGKRDGLVHVSQIKNERLNHPSDVLSEGQEVWVKLLGFDDRGKVRLAMK 693


>PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 806

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFVE+  G  GL+HIS+IA   V  V+D L+EGD V V + G +   R+ LS K
Sbjct: 637 FGAFVEIFPGTDGLLHISEIAEHRVKEVKDELHEGDQVMVKVLGVEG-NRIKLSRK 691


>IF2A_METJA RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 266

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 24/62 (38%), Positives = 43/62 (69%), Gaps = 3/62 (4%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIKD 92
          +GAFVEL    G++G++HIS++   +V N+RD++  G  +V  +++  + KG +DLS+K 
Sbjct: 25 YGAFVELLEYPGKEGMIHISEVTSGWVKNIRDHVKVGQRVVAKVLRVDERKGHIDLSLKR 84

Query: 93 LT 94
          +T
Sbjct: 85 VT 86


>IF2A_HALMA RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 266

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 26/61 (42%), Positives = 43/61 (70%), Gaps = 3/61 (4%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIKD 92
          FG FV+L    G++GL HIS++A  ++ NVRD++NEG  +V  ++   ++  ++DLSIKD
Sbjct: 23 FGVFVDLDEYEGKRGLCHISEVASGWIKNVRDHVNEGQTVVAKVLDVDESAQQIDLSIKD 82

Query: 93 L 93
          +
Sbjct: 83 V 83


>PNP_SORC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 25/68 (36%), Positives = 35/68 (51%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+     GL+HIS++AH  V  V D + EGD + V + 
Sbjct: 619 EPEVGATYKGTVKRITDFGAFVEILPNTDGLLHISEMAHTRVERVEDVVKEGDSLDVKVL 678

Query: 79  GRDAKGRL 86
             D +G++
Sbjct: 679 SVDREGKI 686


>PNP_PERMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +++E G            +GAFVEL  G+  L+H+SQI+ E + + ++ +  GDI+ V +
Sbjct: 621 MDIELGEVYMGKVTRVEDYGAFVELMPGKLSLLHVSQISPERIRSAKEKIKVGDILTVKV 680

Query: 78  KGRDAKGRLDLSIKDL 93
              D  GR  +S+K++
Sbjct: 681 IDIDEMGRAKVSLKEV 696


>PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 695

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/58 (41%), Positives = 36/58 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV +  G  GLVHIS++A+  V  V D + EG++++V +      G++ LS K L
Sbjct: 633 FGAFVRIKTGTDGLVHISELANHRVKKVTDVVKEGEVIRVKVLEITRDGKIRLSCKAL 690


>PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFVE+  G++GLVHIS++    V  V D ++ GD + V +   D +GR++LS
Sbjct: 634 NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDIDNQGRINLS 688


>PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 23/58 (39%), Positives = 40/58 (68%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV +  G++GL+HISQI+++ +  V ++L    I+ V +   D +GR+ LS+K++
Sbjct: 636 FGAFVSIGFGKEGLIHISQISNKRIDKVINHLKINQIIFVKVLEVDRQGRIRLSMKNI 693


>IF2A_THEON RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 275

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 3/59 (5%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          +GAF++L    G++G +HIS++A  +V N+RDY+ EG  +V  +I+    KG +DLS+K
Sbjct: 25 YGAFLKLDEYPGKEGFMHISEVASTWVKNIRDYVKEGQKVVAKVIRVDPNKGHIDLSLK 83


>PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 28/74 (37%), Positives = 39/74 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFVE+  G +GL+HISQIA + +  V + L  G+ + V + 
Sbjct: 624 EAELGRIYMGKVTRIVDFGAFVEIMPGVEGLLHISQIADKRIQKVSEVLKTGEQIPVKVI 683

Query: 79  GRDAKGRLDLSIKD 92
             D  GR+ LS K+
Sbjct: 684 EIDELGRVRLSRKE 697


>PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV   G + GLVHISQ+A   V    D + EG  V+V + G D +G+  LS+K
Sbjct: 636 FGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEGAKVKVKLLGFDDRGKTRLSMK 691


>PNP_EHRCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 796

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG++GLVHIS+I +E++++V   ++  D V+VL+ 
Sbjct: 622 EPEIGKVFEGTVVEIMKFGAFVSFLGGKKGLVHISEIRNEHISSVGSVISLNDKVKVLVI 681

Query: 79  GRDAKGRLDLSIK 91
           G D +  + LS++
Sbjct: 682 GID-REHIQLSMR 693


>RS1_SYNP6 RecName: Full=30S ribosomal protein S1;
          Length = 307

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKDL 93
           +GAF+++ GG  GL+HIS+I+H+++       N  D V+V+I   DA +GR+ LS K L
Sbjct: 210 YGAFIDI-GGVSGLLHISEISHDHIETPHSVFNVNDEVKVMIIDLDAERGRISLSTKQL 267


>PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA     NV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA     NV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 710

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA     NV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVGEDVDVKVIKIDEKGRVDASMKAL 695


>PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 27/73 (36%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVH+SQIA + + +  + L EG  V+V + 
Sbjct: 622 EPEEGKIYVGKVVKLVDFGAFVNFFGKRDGLVHVSQIAGKRLNHPNEVLKEGQEVKVKLL 681

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ L +K
Sbjct: 682 GFDDRGKVRLGMK 694


>PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 23/58 (39%), Positives = 36/58 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAF+++  G  GL HIS++ H +V +V D +  GD V+V +     +G++ LS K L
Sbjct: 634 FGAFIQIKNGTDGLCHISELEHHHVKSVTDVVKMGDKVRVKVLEVSPEGKIRLSRKAL 691


>PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 815

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 3/57 (5%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIK 91
           FGAFVE+  G  GL+HIS++A   + +V+D L+EGD  QVL+K     G R+ LS K
Sbjct: 638 FGAFVEILPGTDGLLHISEVAEHRIKDVKDELHEGD--QVLVKVLAVDGNRIKLSRK 692


>RS1A_SYNY3 RecName: Full=30S ribosomal protein S1 homolog A;
          Length = 328

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKDL 93
           +GAF+++ GG  GL+HIS+I+H+++       N  D ++V+I   DA +GR+ LS K L
Sbjct: 209 YGAFIDI-GGVSGLLHISEISHDHIDTPHSVFNVNDEIKVMIIDLDAERGRISLSTKQL 266


>PNP_SOLUE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 24/43 (55%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           FGAFVE+  G  GL+HIS+IA   + +VRD L EGD  Q+L+K
Sbjct: 632 FGAFVEIFPGTDGLLHISEIAENRIKDVRDELKEGD--QILVK 672


>PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 739

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 27/58 (46%), Positives = 36/58 (62%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFVEL  G+  LVHIS++A E V    D +  GD ++V +   D KGR++ S K L
Sbjct: 637 FGAFVELFKGKDALVHISELALERVGQTEDVVKLGDKLKVRVTEVDDKGRVNASHKVL 694


>PNP_COPPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 20/55 (36%), Positives = 37/55 (67%)

Query: 38  AFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           A VE+A G+ GL+H+S+++   + ++ D L+ G  ++V +K +D +GRL  S K+
Sbjct: 637 AIVEIAPGKTGLLHVSEVSETRIRSLEDVLSVGQTIKVWVKEKDGEGRLRFSAKE 691


>PNP_ANAPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 838

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            +GAFV   G  +GLVHIS+I +E++  V D L  GD V+VL+ 
Sbjct: 626 EPEVGKIYSGEVCELAKYGAFVTFLGARKGLVHISEIRNEHINAVADVLAVGDKVKVLVI 685

Query: 79  GRDAKGRLDLSIK 91
             D K  + LS++
Sbjct: 686 DMD-KDHIQLSMR 697


>IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 267

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 25/61 (40%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKD 92
          FG FV+L     ++GLVH+S++A  ++ NVRD++NE   V   + G D    ++DLS+KD
Sbjct: 23 FGVFVDLEQYQDKRGLVHVSEVASGWIKNVRDHVNEDQTVVAKVLGVDESAQQIDLSLKD 82

Query: 93 L 93
          +
Sbjct: 83 V 83


>IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 267

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 25/61 (40%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKD 92
          FG FV+L     ++GLVH+S++A  ++ NVRD++NE   V   + G D    ++DLS+KD
Sbjct: 23 FGVFVDLEQYQDKRGLVHVSEVASGWIKNVRDHVNEDQTVVAKVLGVDESAQQIDLSLKD 82

Query: 93 L 93
          +
Sbjct: 83 V 83


>PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA     NV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTANVADVLEIGEEVDVKVIKIDDKGRVDASMKAL 695


>PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA     NV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTANVADVLEIGEEVDVKVIKIDDKGRVDASMKAL 695


>PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 709

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS+IA     NV D L  G+ V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWTRTANVADVLEIGEEVDVKVIKIDDKGRVDASMKAL 695


>PNP_SALAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 786

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GL+HIS++   + V  V DYLN GD V+V I   D +G++ L
Sbjct: 665 AFGAFVSLLPGRDGLLHISKVGDGKRVEKVEDYLNVGDKVEVEIADIDQRGKIYL 719


>PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 1/56 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAF+E+  G++GL+HIS+I+ E V  V D L+ GD+ +V +   +  G++ LS K
Sbjct: 647 FGAFMEILPGKEGLLHISEISPERVEKVEDVLSVGDVFKVRVISMEG-GKISLSKK 701


>PNP_BRAHW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 3/59 (5%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           FGAFVE+  G +GL HIS++A+++V NV + L  GD  +V +K  D K G+  LS K L
Sbjct: 632 FGAFVEILPGVEGLCHISELAYKHVMNVEEVLKIGD--EVKVKILDVKGGKYSLSRKAL 688


>PNP_BEUC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 744

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           SFGAFV L  G+ GL+HISQI      + V NV D L  G  VQV I   D +G+L L
Sbjct: 664 SFGAFVSLTPGKDGLLHISQIRRLVGGKRVENVEDVLGVGQKVQVEIAEIDPRGKLSL 721


>PNP_EHRCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 796

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG++GL+HIS+I +E+++ V   ++  D V+VL+ 
Sbjct: 622 EPEIGKVFEGTVVEIVKFGAFVNFLGGKRGLIHISEIKNEHISAVGSVISVNDKVKVLVI 681

Query: 79  GRD 81
           G D
Sbjct: 682 GID 684


>PNP_CORA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 756

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GLVHIS++   E +  V D +N GD +QV I   D +G++ L
Sbjct: 696 AFGAFVSLTPGRDGLVHISKLGGDERIEKVEDVVNVGDKIQVEIADIDNRGKISL 750


>PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 734

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI-----KGRDAKGRLDLSIK 91
           GAFVE+     GLVHIS+IA E V  V D+L +GD V+V +       R  K R  LSIK
Sbjct: 654 GAFVEILPRTDGLVHISEIARERVNKVSDHLKQGDRVKVKLIDIRKDQRSGKIRYALSIK 713

Query: 92  DL 93
            L
Sbjct: 714 AL 715


>PNP_ANAVT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 24/53 (45%), Positives = 35/53 (66%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE   G++G++HISQ+A   V  V D +  GD V V ++  D KGR++L+
Sbjct: 646 GAFVEFLPGKEGMIHISQLADYRVGKVEDEVAVGDEVIVKVREIDNKGRINLT 698


>PNP_ANASP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 24/53 (45%), Positives = 35/53 (66%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE   G++G++HISQ+A   V  V D +  GD V V ++  D KGR++L+
Sbjct: 646 GAFVEFLPGKEGMIHISQLADYRVGKVEDEVAVGDEVIVKVREIDNKGRINLT 698


>IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 273

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 25/59 (42%), Positives = 40/59 (67%), Gaps = 3/59 (5%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          +GAF+ L    G++G +HIS++A  +V N+RDY+ EG  +V  +I+    KG +DLS+K
Sbjct: 25 YGAFLILDEYPGKEGFMHISEVAPTWVKNIRDYVKEGQKVVVKVIRVDPEKGHIDLSLK 83


>PNP_THERP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 790

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 23/53 (43%), Positives = 34/53 (64%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE+  G+ G +HIS+IA E V +V D L  G  + V++ G    G+++LS
Sbjct: 648 GAFVEILPGKDGFLHISEIAPERVRSVEDVLKVGQEINVMVIGVRPDGKINLS 700


>PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 27/58 (46%), Positives = 33/58 (56%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A     NV D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNNVEDLVAIGDEVDVKVIKIDEKGRVDASMKAL 695


>PNP_SACEN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 750

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           +FGAFV L  G+ GLVHIS++ + + +  V D +N GD ++V I   D++G++ L + D
Sbjct: 672 AFGAFVSLLPGKDGLVHISKLGNGKRIGKVEDVVNVGDKLRVEIADIDSRGKISLVVVD 730


>PNP_NOSP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 718

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 23/53 (43%), Positives = 35/53 (66%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE   G++G++HISQ+A   V  V D +  GD V + ++  D KGR++L+
Sbjct: 646 GAFVEFLPGKEGMIHISQLADYRVGKVEDEVAVGDEVIIKVREIDNKGRINLT 698


>PNP_EHRRW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 789

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 24/63 (38%), Positives = 35/63 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG++GL+HIS+I +E++  V   ++  D V+VL+ 
Sbjct: 626 EPEIGKVFDGTVIEIVKFGAFVSFLGGKRGLIHISEIKNEHINAVGSVISVNDKVKVLVI 685

Query: 79  GRD 81
           G D
Sbjct: 686 GID 688


>PNP_EHRRG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 789

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 24/63 (38%), Positives = 35/63 (55%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   GG++GL+HIS+I +E++  V   ++  D V+VL+ 
Sbjct: 626 EPEIGKVFDGTVIEIVKFGAFVSFLGGKRGLIHISEIKNEHINAVGSVISVNDKVKVLVI 685

Query: 79  GRD 81
           G D
Sbjct: 686 GID 688


>PNP_ACIC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 782

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 36  FGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FG FV L  G+ GL+HIS++        V NV D L  GD +QV I+  DA+G+L L
Sbjct: 664 FGVFVSLLPGKDGLLHISELRKMAGGRRVENVEDVLKVGDKIQVEIRDIDARGKLSL 720


>MOG5_CAEEL RecName: Full=Probable pre-mRNA-splicing factor
           ATP-dependent RNA helicase mog-5;       
           EC=3.6.1.-;AltName: Full=Sex determination protein
           mog-5;
          Length = 1200

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 4/62 (6%)

Query: 35  SFGAFVELAGGEQ---GLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           SFGAF+ L G  Q   GLVHISQI +E V  V D L  G+ V+V +  +   G++ LS+K
Sbjct: 246 SFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKV-NKIENGKISLSMK 304

Query: 92  DL 93
           ++
Sbjct: 305 EV 306


>PNP_STRAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 740

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HISQI      + V NV D L  G  VQV I   D++G+L L
Sbjct: 663 TFGAFVSLLPGKDGLLHISQIRKLAGGKRVENVEDVLGVGQKVQVEIAEIDSRGKLSL 720


>PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 747

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFV LA G+ G+VH+S++    V NV D +  GD + V++ 
Sbjct: 625 EIKVGDIFLGKVVRIMPFGAFVNLAPGKDGMVHVSELDVGRVENVEDVIKMGDEINVMVI 684

Query: 79  G-RDAKGRLDLSIKDL 93
           G     G++ LS + L
Sbjct: 685 GIEPGTGKVSLSRRAL 700


>PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 746

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E++ G            FGAFV LA G+ G+VH+S++    V NV D +  GD + V++ 
Sbjct: 625 EIKVGDIFLGKVVRIMPFGAFVNLAPGKDGMVHVSELDVGRVENVEDVIKMGDEINVMVI 684

Query: 79  G-RDAKGRLDLSIKDL 93
           G     G++ LS + L
Sbjct: 685 GIEPGTGKVSLSRRAL 700


>PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 704

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAF E+  G+ GL+HIS+I  E    V D L  GD + V +   D +GR++LS K
Sbjct: 635 FGAFCEIFPGKDGLLHISEIQEERTKQVEDVLKLGDQLLVKVIEIDKQGRVNLSRK 690


>PNP_CHLPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 732

 Score = 46.2 bits (108), Expect = 2e-07
 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI-----KGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+I+ E VT V D+L  GD V+V +       R  K R  LSIK
Sbjct: 654 GAFVEFLPKTDGLVHISEISKERVTKVSDHLKVGDRVKVKLVDIRKDPRTGKNRFALSIK 713


>PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 32/58 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FGAFV L      LVHIS++A      V D +  GD V V +   D KGR+D S+K L
Sbjct: 638 FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKAL 695


>PNP_STRGG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 737

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HISQI      + V NV D L  G  VQV I   D++G+L L
Sbjct: 663 TFGAFVSLMPGKDGLLHISQIRKLAGGKRVENVEDVLGVGAKVQVEIAEIDSRGKLSL 720


>PNP_STRCO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 739

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HISQI      + V NV D L  G  VQV I   D++G+L L
Sbjct: 663 TFGAFVSLLPGKDGLLHISQIRKLAGGKRVENVEDVLGVGAKVQVEIAEIDSRGKLSL 720


>PNP_STRAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 738

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HISQI      + V NV D L  G  VQV I   D++G+L L
Sbjct: 663 TFGAFVSLLPGKDGLLHISQIRKLAGGKRVENVEDVLGVGAKVQVEIAEIDSRGKLSL 720


>PNP_STAAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_STAA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 698

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFV L  G+  L+HISQI+   +  V D L  GD ++V I   D +GR++ S + L
Sbjct: 639 YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRAL 696


>PNP_SALTO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 785

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAF+ L  G  GL+HIS++   + V  V D+LN GD V+V I   D +G++ L
Sbjct: 665 AFGAFISLLPGRDGLLHISKVGDGKRVEKVEDFLNVGDKVEVEIADIDQRGKIYL 719


>PNP_RHOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 753

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 22/54 (40%), Positives = 35/54 (64%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           FGAFVE+  G  GLVHIS+++  Y++++   +  GD ++VL+   D   R+ LS
Sbjct: 637 FGAFVEILPGRDGLVHISEMSGGYISSLDQVIAVGDAMKVLVIDVDEHDRVKLS 690


>PNP_NITSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 732

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 33/58 (56%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV 75
           V+ + G           +FGAFVEL GG  GL+HIS+++   V  V D +N GD V+V
Sbjct: 654 VKFQEGDILKGKIKRTTNFGAFVELPGGVDGLLHISKLSSGRVERVEDVVNIGDEVEV 711


>PNP_BLOPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 699

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            FGAFV +  G++GLVHISQI+   +  V DY             
Sbjct: 621 VEIGAVYTGKVSHIVEFGAFVTILSGKEGLVHISQISERRINKVTDYXXXXXXXXXXXXE 680

Query: 80  RDAKGRLDLSIK 91
            D +GR+ LS+K
Sbjct: 681 IDRQGRIRLSMK 692


>RS1_HELPY RecName: Full=30S ribosomal protein S1;
          Length = 556

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 30/57 (52%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIK 91
           FG FVE A G +GLVH S+I+H+   N   Y  EGD V V     DA K RL LSIK
Sbjct: 217 FGIFVE-AKGIEGLVHYSEISHKGPVNPEKYYKEGDEVYVKAIAYDAEKRRLSLSIK 272



 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIA-HEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKDL 93
           +G FV++    +G +H+S+I+  + V++  +YL+ G  + V I   D K  RL +S+K L
Sbjct: 302 YGVFVDIGNDIEGFLHVSEISWDKNVSHPNNYLSVGQEIDVKIIDIDPKNRRLRVSLKQL 361

Query: 94  T 94
           T
Sbjct: 362 T 362


>PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 719

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 23/60 (38%), Positives = 42/60 (70%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDY-LNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +GAF+E   G++GL+HIS+I+ +++ ++ +  LNEGD +++ +   D+K G+  LS K L
Sbjct: 642 YGAFIEFLPGKEGLLHISEISWKHLESIEEAGLNEGDFIKIKLVDIDSKTGKFKLSHKIL 701


>IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 267

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 22/61 (36%), Positives = 41/61 (67%), Gaps = 3/61 (4%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIKD 92
          FGAFV L    G +G+VHIS++A  ++ ++R+++ +G  ++  ++     +G +DLSIKD
Sbjct: 30 FGAFVSLDEYEGREGMVHISEVASGWIKDIREHVKKGQKVICKVLDVNPKRGHIDLSIKD 89

Query: 93 L 93
          +
Sbjct: 90 V 90


>PNP_CORU7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 765

 Score = 45.1 bits (105), Expect = 4e-07
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHE-YVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAF+ L  G  GL+HIS I  +  +  V D LN GD +QV I   D +G++ L
Sbjct: 705 AFGAFISLLPGRDGLLHISNIGGDRRIEKVEDELNVGDKIQVEIADIDNRGKISL 759


>PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 26/74 (35%), Positives = 36/74 (48%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFVE+A G++GLVHIS ++             GD + V + 
Sbjct: 616 DIEVGGIYLGKVLRIAPFGAFVEIAPGKEGLVHISNLSXXXXXXXXXXXXXGDNILVKVT 675

Query: 79  GRDAKGRLDLSIKD 92
             D  GR+ LS KD
Sbjct: 676 EIDKLGRIVLSRKD 689


>PNP_THEFY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 767

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HISQI      + + NV D ++ G+ + V ++  D +G+L L
Sbjct: 658 AFGAFVSLLPGKDGLLHISQIRKMHGGQRIENVEDVISIGEKIHVEVRDIDERGKLSL 715


>PNP_SULDN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +E + G            FGAF+EL  G  GL+HIS+I+ + V  V D L EG+ + V I
Sbjct: 649 IEYKVGDIHKGIVKKIVEFGAFIELPDGVDGLLHISKISDQRVEKVSDILKEGEEINVEI 708


>PNP_SPICI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FG FV L     GL+HIS++A ++V    D +   DIV+V +   D KG++ L + ++
Sbjct: 641 FGVFVHLKENLDGLIHISKLAKQHVEKAEDIVQLNDIVKVKVIEIDGKGKIKLQLIEI 698


>PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 21/73 (28%), Positives = 40/73 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FG FVE+  G++GL HIS+     + ++ +++ +GD++ V + 
Sbjct: 619 EIEIGRIYSGKAISIAPFGVFVEILPGKEGLCHISEFDVNRINSLDEFVKQGDMLMVKVL 678

Query: 79  GRDAKGRLDLSIK 91
             + +G++ LS K
Sbjct: 679 DINERGQIKLSRK 691


>PNP_NOCFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 764

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GLVHIS++ + + V  V D +N GD ++V I   D +G++ L
Sbjct: 690 AFGAFVSLLPGRDGLVHISKLGNGKRVAKVEDVVNVGDKLRVEIADIDNRGKISL 744


>ISPH_CLOAB RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
           reductase;         EC=1.17.1.2;
          Length = 642

 Score = 44.7 bits (104), Expect = 5e-07
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           FGAFV+L  G  GLVHIS+I+H+ +    D LN G+ ++  +++    + ++ LSI+++
Sbjct: 582 FGAFVKLEPGVDGLVHISEISHKRIAKPSDALNVGEEIKAKILEVSSEEKKIGLSIREV 640



 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +LE G            FGAFVE+ G + GL+H+S+I+   V    D L  GD ++V + 
Sbjct: 480 KLEEGQVVEGEVKRLTDFGAFVEIEGVD-GLLHVSEISWGRVEKPADVLKIGDKIKVYVL 538

Query: 79  GRDAKG-RLDLSIKDLT 94
             D +  +L LS+K LT
Sbjct: 539 SVDKENKKLSLSVKKLT 555


>PNP_RHOE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 756

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GLVHIS++ + + +  V D +N G  ++V I   DA+G++ L
Sbjct: 681 AFGAFVSLLPGRDGLVHISKLGSGKRIAKVEDVVNVGSKIRVEIADIDARGKISL 735


>PNP_PELLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 732

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 27/60 (45%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI-----KGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+I+ E VT V D+L  GD ++V +       R  K R  LS+K
Sbjct: 654 GAFVEFIPKTDGLVHISEISRERVTKVSDHLKVGDRIKVKLVDIRKDPRTGKTRFALSMK 713


>PNP_PSESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 26/75 (34%), Positives = 33/75 (44%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV +  G+ GLVHIS ++   V  V D L           
Sbjct: 619 EAEIGKIYLGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKXXXXXXXXXX 678

Query: 79  GRDAKGRLDLSIKDL 93
               +GR+ LSIKD+
Sbjct: 679 XXXNRGRIKLSIKDV 693


>PNP_PROVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 732

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 28/60 (46%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI-----KGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+IA+E V  V D+L  G+ V+V +       R  K R  LSIK
Sbjct: 654 GAFVEFIPKTDGLVHISEIANERVAKVSDHLKVGERVKVKLVDIRKDPRTGKTRFALSIK 713


>PNP_NEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 24/73 (32%), Positives = 38/73 (52%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +L+ G            FG FV L   ++GLVHIS+I+   V ++R    EG  V V IK
Sbjct: 628 QLKIGELYDGKIVSVVDFGLFVVLPNKQEGLVHISEISKNRVNDIRADYTEGQAVTVRIK 687

Query: 79  GRDAKGRLDLSIK 91
              + G++ L+++
Sbjct: 688 DIGSDGKIKLTMR 700


>PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 755

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRD-AKGRLDLS 89
           FGAFV +  G+ G+VH+S++  + V NV D ++ GD + V++   D   G++ LS
Sbjct: 642 FGAFVNILPGKDGMVHVSELDEKRVENVEDVVSLGDEINVMVIDIDRTTGKISLS 696


>PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 755

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK-GRLDLS 89
           FGAFV +  G+ G+VH+S++  + V NV D ++ GD + V++   D   G++ LS
Sbjct: 642 FGAFVNILPGKDGMVHVSELDEKRVENVEDVVSLGDEINVMVIDIDRNTGKISLS 696


>PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 755

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRD-AKGRLDLS 89
           FGAFV +  G+ G+VH+S++  + V NV D ++ GD + V++   D   G++ LS
Sbjct: 642 FGAFVNILPGKDGMVHVSELDEKRVENVEDVVSLGDEINVMVIDIDRTTGKISLS 696


>PNP_ARTS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 746

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAF+ L  G+ GL+HIS++      + V NV D ++ G  +QV I   D +G+L LS
Sbjct: 668 TFGAFISLTPGKDGLLHISELRKIAGGKRVDNVEDVVSVGQKIQVEITKIDDRGKLSLS 726


>PNP_ARTCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+HIS++      + V NV D ++ G  VQV I   D +G+L LS
Sbjct: 668 TFGAFVSLTPGKDGLLHISELRKLANGKRVDNVDDVVSVGQKVQVEITKIDDRGKLSLS 726


>PNP_ARTAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 750

 Score = 43.9 bits (102), Expect = 9e-07
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+HIS++      + V NV D ++ G  VQV I   D +G+L LS
Sbjct: 668 TFGAFVSLTPGKDGLLHISELRKLANGKRVDNVDDVVSVGQKVQVEITKIDDRGKLSLS 726


>RS1_CHLTR RecName: Full=30S ribosomal protein S1;
          Length = 569

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKD 92
           +FGAFVEL  G +GL+H+S+++ +    + D L+ GD V   +IK      ++ LSIK+
Sbjct: 491 AFGAFVELQNGIEGLIHVSELSEKPFAKIEDVLSIGDKVSAKVIKLDPDHKKVSLSIKE 549



 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKD 92
           ++GAFVEL  G +GL+HIS ++  + V++  +   +G+ V+ +I   D +  ++ L +K 
Sbjct: 404 NYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNTVEAVILSVDKESKKITLGVKQ 463

Query: 93  LT 94
           LT
Sbjct: 464 LT 465


>PNP_UNCTG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 689

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/74 (31%), Positives = 35/74 (47%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           VE E G           +FGAF E+  G++GL+HISQ+++ +                  
Sbjct: 613 VEAEVGKIYKSRVTKIMAFGAFAEILPGKEGLIHISQLSNRHTXXXXXXXXXXXXXXXXX 672

Query: 78  KGRDAKGRLDLSIK 91
              D +GR++LSIK
Sbjct: 673 XXXDKQGRINLSIK 686


>PNP_MYCTU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 679 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 732


>PNP_MYCTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 679 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 732


>PNP_MYCPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 681 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 734


>PNP_MYCMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 762

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 681 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 734


>PNP_MYCBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 679 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 732


>PNP_MYCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 679 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 732


>PNP_MYCBO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 679 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 732


>PNP_MYCA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 748

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 672 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 725


>PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           FGAFVE   G++GL+HIS++  E + N+   L  G+++ V +   D K G+  LS K L
Sbjct: 646 FGAFVEFMPGKEGLLHISEVKWERIENLDQVLELGEVIPVKLLEIDPKSGKYKLSRKVL 704


>PNP_PHYMT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +FGA  E+  G +G +HIS++ +  V  V D L  G I+ V     + +G++DLS KD+
Sbjct: 668 TFGAIAEIFPGIEGFIHISKLENYKVDKVEDVLKIGQIILVKCIKINERGQIDLSKKDV 726


>PNP_ORITI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 736

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 20/55 (36%), Positives = 34/55 (61%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAF++   G  G VHIS+I   ++ ++  ++  GD V+V I G D K R+ L+++
Sbjct: 638 GAFIKYVTGRDGFVHISEINDTHIKDINAHVKLGDKVKVKIIGIDHKNRVKLTLR 692


>PNP_ORITB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 740

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 20/55 (36%), Positives = 34/55 (61%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAF++   G  G VHIS+I   ++ ++  ++  GD V+V I G D K R+ L+++
Sbjct: 642 GAFIKYVTGRDGFVHISEINDTHIKDINAHVKLGDKVKVKIIGIDHKNRVKLTLR 696


>PNP_MYCUA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 762

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 681 FGAFVALLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISL 734


>PNP_MYCA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 755

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +  GD +QV I   D +G++ L
Sbjct: 677 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVKVGDKIQVEIADIDNRGKISL 730


>PNP_MICLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 753

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+H+S++      + V +V D L  G  VQV I   D +G+L LS
Sbjct: 672 TFGAFVSLTPGKDGLLHVSELRKLNEGKRVDDVEDVLGVGQKVQVEITKIDDRGKLSLS 730


>PNP_KINRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 746

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HISQ+      + V NV D +  G  VQV I   D +G+L L
Sbjct: 669 TFGAFVSLMPGKDGLLHISQLRKLSGGKRVDNVEDVVAVGQKVQVEIAEIDPRGKLSL 726


>PNP_DEHE1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 22/71 (30%), Positives = 38/71 (53%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++EAG+          +FGAFVE+  G++G+VHIS++A                + V + 
Sbjct: 616 DVEAGSVYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRXXXXXXXXXXXXXITVKVT 675

Query: 79  GRDAKGRLDLS 89
             D++GR++LS
Sbjct: 676 EIDSQGRINLS 686


>PNP_CORDI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 755

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   D +G++ L+
Sbjct: 694 AFGAFVSLLPGRDGLVHISKLGGGKRIEKVEDVVNVGDKLEVEILDIDNRGKISLA 749


>PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 25/74 (33%), Positives = 36/74 (48%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G           +FGAFVE+  G+ GLVHIS              + GD + V + 
Sbjct: 619 DIEPGEVYLGKVVRITTFGAFVEILPGKDGLVHISXXXXXXXXXXXXXXSIGDEILVKVT 678

Query: 79  GRDAKGRLDLSIKD 92
             D +GR++LS KD
Sbjct: 679 EIDKQGRINLSRKD 692


>RS1_CHLMU RecName: Full=30S ribosomal protein S1;AltName: Full=70
           kDa antigen;
          Length = 570

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKD 92
           +FGAFVEL  G +GL+H+S+++ +    + D L+ GD V   +IK      ++ LSIK+
Sbjct: 491 AFGAFVELQNGIEGLIHVSKLSDKPFAKIEDILSIGDKVSAKVIKLDPDHKKVSLSIKE 549



 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKD 92
           ++GAFVEL  G +GL+HIS ++  + V++  +   +G+ V+ +I   D +  ++ L +K 
Sbjct: 404 NYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNTVEAVILSVDKESKKITLGVKQ 463

Query: 93  LT 94
           LT
Sbjct: 464 LT 465


>PNP_SULNB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 21/66 (31%), Positives = 34/66 (51%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           ++ E G            FG FVE+  G   L+HIS++A E V N+ +  +EGD + V++
Sbjct: 653 MQYEVGKTYVGKVKKIVDFGIFVEMPDGFDALLHISKVAKERVNNLNERYHEGDDITVVV 712

Query: 78  KGRDAK 83
             +  K
Sbjct: 713 MEQKGK 718


>PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 733

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI-----KGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+IA E +  V D L  GD ++V +       R  K +  LSIK
Sbjct: 654 GAFVEFLPKTDGLVHISEIARERIAKVSDVLKVGDRIKVKLIDVRKDPRTGKTKFALSIK 713

Query: 92  DL 93
            L
Sbjct: 714 AL 715


>PNP_CARHZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 731

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 29/80 (36%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLV------HISQIAHEYVTNVRDYLNEGDI 72
           E+E G            FGAF                 HISQ+AH  V  V D + EGD 
Sbjct: 629 EIEVGKVYLGKVTRIADFGAFXXXXXXXXXXXXXXXXXHISQLAHSRVKRVEDVVKEGDQ 688

Query: 73  VQVLIKGRDAKGRLDLSIKD 92
           + V   G D +GRL LS KD
Sbjct: 689 ILVKAIGYDNQGRLKLSRKD 708


>RS1_CHLPN RecName: Full=30S ribosomal protein S1;
          Length = 580

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 22  AGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGR 80
           AGT          +FGAFVEL  G +GL+H+S+++ +    + D ++ G+ V   +IK  
Sbjct: 478 AGTVISGVVTKITAFGAFVELQNGIEGLIHVSELSDKPFAKIEDIISIGENVSAKVIKLD 537

Query: 81  DAKGRLDLSIKD 92
               ++ LS+K+
Sbjct: 538 PDHKKVSLSVKE 549



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 20/62 (32%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKD 92
           ++GAFVEL  G +GL+HIS ++  + V++  +   +G+ V+ +I   D +  ++ L +K 
Sbjct: 404 NYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNSVEAVILSVDKESKKITLGVKQ 463

Query: 93  LT 94
           L+
Sbjct: 464 LS 465


>PNP_FRASN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+H+S++      + V  V D L+ G  +QV I   DA+G++ L+
Sbjct: 658 NFGAFVSLTPGKDGLLHVSKLKQLAGGKRVEKVEDVLSVGQKLQVEITEIDARGKISLA 716


>PNP_MYCLE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 773

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   + +G++ L
Sbjct: 682 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIEKRGKISL 735


>PNP_MYCLB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 773

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D +N GD ++V I   + +G++ L
Sbjct: 682 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVEIADIEKRGKISL 735


>PNP_KOCRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 751

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+HIS++      + V  V D L+ G  VQV I   D +G+L L+
Sbjct: 677 TFGAFVSLTPGKDGLLHISEMRQLNDDKRVNEVDDVLSVGQKVQVEITKVDDRGKLSLA 735


>PNP_COREF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 752

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GLVHIS++ + + V  V D +  G+ +QV I   D +G++ L
Sbjct: 691 AFGAFVSLLPGRDGLVHISKLGNGKRVEKVEDVVTVGEKLQVEIADIDNRGKISL 745


>PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 732

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI-----KGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+IA E +  V D L  G+ V+V +       R  K +  LSIK
Sbjct: 653 GAFVEFLPKTDGLVHISEIARERIAKVSDVLKPGERVKVKLIDIRKDPRTGKTKFALSIK 712

Query: 92  DL 93
            L
Sbjct: 713 AL 714


>IF2A_METST RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 260

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 36 FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          +GAF +L    G++  +HIS+++  +V N+RDY+ E   IV  +++    KG +D S+K
Sbjct: 25 YGAFAKLEEYEGKEAFIHISEVSSGWVKNIRDYVRENQKIVARVLRVNPKKGHVDASLK 83


>RS1_COXBU RecName: Full=30S ribosomal protein S1;
          Length = 551

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LI 77
           EL+ G            +GAFV+L GG  GL+HI+ +A   V +  D LN GD V V ++
Sbjct: 184 ELQEGQEIKGVIKNITDYGAFVDL-GGVDGLLHITDMAWGRVKHPSDLLNVGDEVHVKVL 242

Query: 78  KGRDAKGRLDLSIKDL 93
           K    K R+ L +K L
Sbjct: 243 KFDRDKKRVSLGMKQL 258



 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 36  FGAFVELAGGEQGLVHISQIA--HEYVTNVRDYLNEGDIVQVLIKGRD-AKGRLDLSIKD 92
           FG F+ L G   GLVH+S I+        +R+Y  +GD VQ +I G D  + R+ L IK 
Sbjct: 373 FGMFIGLEGDIDGLVHLSDISWTESGEEAIRNY-KKGDEVQAVILGIDPERERISLGIKQ 431

Query: 93  L 93
           L
Sbjct: 432 L 432


>PNP_METS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 725

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 33/73 (45%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E EAG            FGAFV   G + GLVHIS++A + V                  
Sbjct: 619 EPEAGMIYDGTVVKTMEFGAFVNFFGAKDGLVHISELAPQRVAXXXXXXXXXXXXXXXFL 678

Query: 79  GRDAKGRLDLSIK 91
           G+D +G++ LS+K
Sbjct: 679 GQDERGKIRLSMK 691


>PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 707

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FG F+E+ G  +GLVHIS+++   V  V   +  G+ + V   G D KGR   S K
Sbjct: 640 FGCFIEIKGKGEGLVHISELSDTPVRRVDQVVRVGEEIWVKCIGVDEKGRYKFSRK 695


>PNP_METFK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDY 66
           E+E G            FGA V L  G+ GL+HISQIAH+ V  V D+
Sbjct: 618 EVEVGQVYDGTVLKLLDFGAIVSLLPGKDGLLHISQIAHQRVNAVADF 665


>PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYV--TNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFVE+  G+ GL+HIS+           R+ +N GD + + +   D  GR+ LS KDL
Sbjct: 634 YGAFVEILPGKIGLLHISKYKTTGTGKNQTREEINLGDEILIKVDSIDPSGRISLSRKDL 693


>PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 730

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 24/73 (32%), Positives = 32/73 (43%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVH+SQ+A+E V                + 
Sbjct: 621 EPEVGQIYEGTVVKVVDFGAFVNFFGSKDGLVHVSQMANERVAKPSXXXXXXXXXXXXLM 680

Query: 79  GRDAKGRLDLSIK 91
           G D +G+  LS+K
Sbjct: 681 GFDERGKTRLSMK 693


>PNP_METNO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 725

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 23/73 (31%), Positives = 33/73 (45%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E EAG            FGAF+   G + GLVHIS++A + V                  
Sbjct: 619 EPEAGMIYDGTVVKTMEFGAFINFFGAKDGLVHISELAPQRVAXXXXXXXXXXXXXXXFL 678

Query: 79  GRDAKGRLDLSIK 91
           G+D +G++ LS+K
Sbjct: 679 GQDERGKIRLSMK 691


>PNP_FRASC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G  GL+H+S++      + V  V D L  G  +QV I   D++G++ LS
Sbjct: 658 NFGAFVSLTPGRDGLLHVSKLKTLSGGKRVEKVEDVLTVGQKLQVEITEIDSRGKISLS 716


>PNP_DICT6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 693

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYV--TNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           +GAFVE+  G+ GL+HIS+           R+ +N GD + + +   D+ GR+ L+ KDL
Sbjct: 634 YGAFVEILPGKIGLLHISKYKTTGTGKNQTREEINLGDEILIKVDSIDSSGRISLTRKDL 693


>PNP_CLAMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+HIS++      + V NV D L  G  + V I   D +G+L L+
Sbjct: 674 TFGAFVSLLPGKDGLLHISEVRKLAGGKRVENVEDVLGVGQKILVEITKIDDRGKLSLA 732


>PNP_CLAM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+HIS++      + V NV D L  G  + V I   D +G+L L+
Sbjct: 674 TFGAFVSLLPGKDGLLHISEVRKLAGGKRVENVEDVLGVGQKILVEITKIDDRGKLSLA 732


>PNP_ACHLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           G F E+  G +GLVHIS+   E   ++   +  GD + V +   D +GR+DLS KD
Sbjct: 658 GVFAEIFPGTEGLVHISKWEKERTESLDGKVKVGDQILVKVVKIDERGRVDLSRKD 713


>YHGF_ECOLI RecName: Full=Protein yhgF;
          Length = 773

 Score = 40.8 bits (94), Expect = 7e-06
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +L+ G           +FGAFV++   + GLVHIS +++++V +    +  GDIV+V +
Sbjct: 647 DLQPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLSNKFVEDPHTVVKAGDIVKVKV 705


>RS1_HELPJ RecName: Full=30S ribosomal protein S1;
          Length = 552

 Score = 40.8 bits (94), Expect = 7e-06
 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIK 91
           FG FV+  G + GLVH S+I+H+   N   Y  EGD V V  I   + K RL LSIK
Sbjct: 213 FGIFVKFKGID-GLVHYSEISHKGPVNPEKYYKEGDEVYVKAIAYDEEKRRLSLSIK 268



 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIA-HEYVTNVRDYLNEGDIVQVLIKGRDAKG-RLDLSIKDL 93
           +G FV++    +G +H+S+I+  + V++   YL+ G  + V I   D K  RL +S+K L
Sbjct: 298 YGVFVDIGNDIEGFLHVSEISWDKNVSHPSHYLSVGQEIDVKIIDIDPKNRRLRVSLKQL 357

Query: 94  T 94
           T
Sbjct: 358 T 358


>PNP_PROAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 733

 Score = 40.8 bits (94), Expect = 7e-06
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           SFGAFV L  G+ GL+HIS++      + V  V D L+ G  +QV I   D +G+L L
Sbjct: 665 SFGAFVSLLPGKDGLLHISKMRDLNDGKRVEAVEDVLSVGQKIQVEIAEVDDRGKLSL 722


>PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 40.8 bits (94), Expect = 7e-06
 Identities = 24/75 (32%), Positives = 31/75 (41%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHIS++A E V                  
Sbjct: 619 EPELGVIYNGKVVKVVDFGAFVNFLGSRDGLVHISELARERVAKTAXXXXXXXXXXXXXL 678

Query: 79  GRDAKGRLDLSIKDL 93
           G D +G++ LS+K +
Sbjct: 679 GFDDRGKVKLSMKQV 693


>PNP_GRAFK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 750

 Score = 40.8 bits (94), Expect = 7e-06
 Identities = 26/69 (37%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 21  EAGTXXXXXXXXXXSFGAFVEL--AGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E G+           FGA VE   A G + L+HIS++A E   +V D L  GD++ V   
Sbjct: 628 EKGSVYEVKVIKVLDFGAVVEYMDAPGNEVLLHISELAWERTNDVNDVLKLGDVLDVKYF 687

Query: 79  GRDAKGRLD 87
           G D K R D
Sbjct: 688 GLDPKTRKD 696


>PNP_RENSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 746

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+H++++      + V NV D ++ G  +QV I   D +G+L L
Sbjct: 664 TFGAFVSLTPGKDGLLHVTELRKINDGKRVDNVDDVVSVGQKIQVEITKIDDRGKLSL 721


>PNP_MYCVP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 754

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D    GD ++V I   D +G++ L
Sbjct: 675 FGAFVSLLPGRDGLVHISKLGRGKRINKVEDVAKVGDKLRVEIADIDNRGKISL 728


>PNP_MYCSS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 759

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D    GD ++V I   D +G++ L
Sbjct: 672 FGAFVSLLPGRDGLVHISKLGRGKRIAKVEDVAKVGDKLRVEIADIDNRGKISL 725


>PNP_MYCSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 759

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D    GD ++V I   D +G++ L
Sbjct: 672 FGAFVSLLPGRDGLVHISKLGRGKRIAKVEDVAKVGDKLRVEIADIDNRGKISL 725


>PNP_MYCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 759

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D    GD ++V I   D +G++ L
Sbjct: 672 FGAFVSLLPGRDGLVHISKLGRGKRIAKVEDVAKVGDKLRVEIADIDNRGKISL 725


>PNP_MYCGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 756

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FGAFV L  G  GLVHIS++   + +  V D    GD ++V I   D +G++ L
Sbjct: 677 FGAFVSLLPGRDGLVHISKLGRGKRINKVEDVAKVGDKLRVEIADIDNRGKISL 730


>PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 777

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVL-IKGRDAKGRLDLS 89
           +GAFV +  G+ G+VH+S++  + V NV D +  GD + V+ I      G+L LS
Sbjct: 643 YGAFVNVLPGKDGMVHVSELDEKRVENVEDVVKIGDELTVMVIDVEPGTGKLSLS 697


>PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +FGAFVE   G+ GL+HIS+I  E +  +   L  G+ V+V +   D K G+  LS K L
Sbjct: 646 AFGAFVEFLPGKDGLLHISEIKWERLDTMEGVLEVGETVKVKLVEVDKKTGKYRLSRKVL 705


>PNP_CORK4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 775

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV +     GLVHIS++   + +  V D +N GD ++V I   D +G++ L
Sbjct: 716 AFGAFVSILPNRDGLVHISKLGGKKRIEKVEDVVNVGDKLEVEIADIDNRGKISL 770


>PNP_CORJK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 764

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHE-YVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GL+HIS +  +  +  V D ++ GD ++V I   D +G++ L
Sbjct: 704 AFGAFVSLLPGRDGLIHISNLGGDRRIERVEDEVSVGDKLEVEIADIDNRGKISL 758


>PNP_CHLCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 27/62 (43%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGD-----IVQVLIKGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+I+   V  V D+L  GD     +V V    R  K +  LSIK
Sbjct: 654 GAFVEFLPKTDGLVHISEISSTRVAKVSDHLKVGDKVTVKLVDVRKDPRTGKTKFALSIK 713

Query: 92  DL 93
            L
Sbjct: 714 AL 715


>IF2A_METTH RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 262

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 35 SFGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          ++GAF  L    G++  +HIS+++  +V N+RD++ E   IV  +++    KG +D+S+K
Sbjct: 27 NYGAFATLEEYPGKEAFIHISEVSSGWVKNIRDFVRENQKIVARVLRVNPRKGHVDVSMK 86


>IF2A_METKA RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 267

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 37 GAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIKDL 93
          GAFV L    G  G +HIS++A  +V N+RDY+ EG  +V  +I+    +   +LS++ +
Sbjct: 26 GAFVTLDEYPGVDGYIHISEVASGWVKNIRDYVKEGQKVVAKVIRVNPKRKYANLSLRKV 85

Query: 94 T 94
          T
Sbjct: 86 T 86


>PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 730

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG 79
           +E G            FG FVE   G +GL H+S++A   V    D +  GD + V   G
Sbjct: 639 IEVGKIYTGRVTGVKEFGCFVECTPGNEGLCHVSELADFRVRRTEDVVKMGDSITVKCIG 698

Query: 80  RDAK-GRLDLSIK 91
            D + G++ LS K
Sbjct: 699 IDERSGKVRLSRK 711


>PNP_METRJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 739

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVHIS++A + V                  
Sbjct: 619 EPEVGVIYDGTIVKCMEFGAFVNFFGAKDGLVHISELAAQRVAXXXXXXXXXXXXXXXFL 678

Query: 79  GRDAKGRLDLSIK 91
           G+D +G++ LS+K
Sbjct: 679 GQDDRGKIRLSMK 691


>PNP_FLAPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 36  FGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGR 85
           FGA VE     G + L+H+S++A E   NV D +N GD+  V   G D K R
Sbjct: 640 FGAVVEYTAVPGNEVLLHVSELAWERTENVTDVVNMGDVFMVKYLGLDPKTR 691


>PNP_ANATD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 24/74 (32%), Positives = 33/74 (44%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           S+GAFVE+  G++GLVHISQ+    + +                
Sbjct: 617 EIEVGQFFLGKVTRTASYGAFVEIYPGKEGLVHISQLDERRLKSXXXXXXXXXXXXXXXX 676

Query: 79  GRDAKGRLDLSIKD 92
             D  GRL LS K+
Sbjct: 677 XXDKLGRLSLSRKE 690


>ISPH_FUSNN RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
           reductase;         EC=1.17.1.2;
          Length = 827

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           E + GT           FG F+EL  G  G +     + E++ N+RD  +EGD+V+  +
Sbjct: 729 EYKVGTTVEKKIKTVADFGLFIELIKGIDGFIPTQFASKEFIKNIRDKFSEGDVVKAQV 787



 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIA-HEYVTNVRDYLNEGDIVQVLIKGRDAKGR-LDLSIKDL 93
           +GAFVE+  G +GLVHIS  +  +   NV DY+ E + ++V I     + R L L IK L
Sbjct: 575 YGAFVEIKPGVEGLVHISDFSWTKKKVNVADYVKEREKIKVRITDLHPEDRKLKLGIKQL 634


>PNP_PELPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGD-----IVQVLIKGRDAKGRLDLSIK 91
           GAFVE      GLVHIS+I+ E VT V D+L  G+             R  K R  LSIK
Sbjct: 654 GAFVEFLPKTDGLVHISEISSERVTKVSDHLKIGEXXXXXXXXXXXXSRTGKTRFALSIK 713


>PNP_MAGSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 23/75 (30%), Positives = 34/75 (45%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G            FGAFV +   + GLVHISQ+A+  V N                
Sbjct: 621 EVEKGQVYEGKVVRITDFGAFVNILPNKDGLVHISQLANRRVQNXXXXXXXXXXXXXXXL 680

Query: 79  GRDAKGRLDLSIKDL 93
             D +GR+ L++K++
Sbjct: 681 DVDRQGRVKLTMKEM 695


>IF2A_METS3 RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 265

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 35 SFGAFVELAG--GEQGLVHISQIAHEYVTNVRDYLNEGD-IVQVLIKGRDAKGRLDLSIK 91
          ++GAF +L    G++  +HIS+++  +V N+RD++ E   IV  +++    KG +D S+K
Sbjct: 24 NYGAFAKLEEYHGKEAFIHISEVSSGWVKNIRDHVRENQKIVCRVLRVNPKKGHVDASLK 83


>PNP_RHOSR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GLVHIS++ + + +  V D ++ G  ++V I   D +G++ L
Sbjct: 681 AFGAFVSLLPGRDGLVHISKLGSGKRIAKVEDVVSVGSKLRVEIADIDNRGKISL 735


>PNP_RHOOB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 757

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 35  SFGAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G  GLVHIS++ + + +  V D ++ G  ++V I   D +G++ L
Sbjct: 681 AFGAFVSLLPGRDGLVHISKLGSGKRIAKVEDVVSVGSKLRVEIADIDNRGKISL 735


>PNP_NOCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 742

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           +FGAFV L  G+ GL+HIS++      + V  V D ++ G  +QV I   D +G+L L
Sbjct: 664 NFGAFVSLMPGKDGLLHISKLRSLAGGKRVDAVEDVVSVGQKIQVQIAEIDDRGKLSL 721


>PNP_MYCS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 763

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAH-EYVTNVRDYLNEGDIVQVLIKGRDAKGRL 86
           FGAFV L  G  GLVHIS++   + +  V D +  GD ++V I   D +G++
Sbjct: 676 FGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVKVGDKLRVEIADIDNRGKI 727


>PNP_FRAAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRL 86
           +FGAFV L  G  GL+H+S++      + V  V D L  G  +QV I   DA+G++
Sbjct: 659 NFGAFVSLTPGRDGLLHVSKLKTLSGGKRVEKVEDVLTVGQKLQVEITEIDARGKI 714


>PNP_CALS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 701

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 23/74 (31%), Positives = 35/74 (47%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E+E G           S+GAFVE+  G++GLVHISQ+ ++ + +                
Sbjct: 617 EIEVGQFFLGKVTRTASYGAFVEIYPGKEGLVHISQLDNKKLKSXXXXXXXXXXXXXXXX 676

Query: 79  GRDAKGRLDLSIKD 92
             D  GR+ LS K+
Sbjct: 677 XXDRLGRIALSRKE 690


>PNP_BREBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           +GAF+EL  G++GL HISQ+A E V                    D +GR++LS K
Sbjct: 640 YGAFIELFAGKEGLCHISQLAEERVAKTEXXXXXXXXXXXXXTEIDDQGRVNLSRK 695


>Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;
          Length = 762

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +L++G           +FGAFV++   + GLVHIS ++ ++V +    +  G+IV+V +
Sbjct: 647 DLKSGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVEDPHQVVKTGNIVKVKV 705


>PNP_WOLPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 758

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           ELE G+               +EL  G +G +HIS++A+++V ++ D L +GD  + LI
Sbjct: 614 ELEQGSIIDAKVVKIEKSIVELELLNGRKGKMHISEVANQHVESIEDILKQGDTFKALI 672


>PNP_LACLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 769

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           SFGAFV L G +  +VHIS++A      V D +  G             GR+D S++ L
Sbjct: 638 SFGAFVNLFGKQDAMVHISEMAWARTAKVEDVMKLGXXXXXXXXXXXXXGRVDASMRAL 696


>PNP_LACLM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 766

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           SFGAFV L G +  +VHIS++A      V D +  G             GR+D S++ L
Sbjct: 638 SFGAFVNLFGKQDAMVHISEMAWARTAKVEDVMKLGXXXXXXXXXXXXXGRVDASMRAL 696


>PNP_AERS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 713

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 23/56 (41%), Positives = 27/56 (48%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV +  G+ GLVHISQI    V NV                   +GR+ LSIK
Sbjct: 634 FGAFVNILPGKDGLVHISQITDARVQNVAXXXXXXXXXXXXXXXXXRQGRVRLSIK 689


>RS1_BUCBP RecName: Full=30S ribosomal protein S1;
          Length = 566

 Score = 38.5 bits (88), Expect = 4e-05
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDLT 94
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD V++ ++K    K R+ L +K L+
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNIGDEVKIKILKFDREKIRVSLGLKQLS 263


>PNP_SULSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 38.5 bits (88), Expect = 4e-05
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 18  VELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           +++E G            +GAFVEL  G+  L+H+SQI+ E + +               
Sbjct: 615 MDIELGEVYLGKVTRVEDYGAFVELMPGKLSLLHVSQISSERLKSAXXXXXXXXXXXXXX 674

Query: 78  KGRDAKGRLDLSIKDL 93
              D +GR+ +S+KD+
Sbjct: 675 SEIDDQGRIKVSLKDV 690


>PNP_PROA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 734

 Score = 38.5 bits (88), Expect = 4e-05
 Identities = 26/62 (41%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKG-----RDAKGRLDLSIK 91
           GAFVE      GLVHIS+I++E V  V D+L  G              R  K R  LSIK
Sbjct: 656 GAFVEFLPKTDGLVHISEISNERVAKVSDHLKPGXXXXXXXXXXXXXPRTGKTRFALSIK 715

Query: 92  DL 93
            L
Sbjct: 716 AL 717


>PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 746

 Score = 38.5 bits (88), Expect = 4e-05
 Identities = 26/60 (43%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDY-LNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +GAFVE   G+ GL+HIS+I  + +  V    L EGD V V +   D K G+  LS K L
Sbjct: 642 YGAFVEFMPGKDGLLHISEIDWKRLETVEQAGLKEGDTVSVKLVDIDPKTGKFKLSRKVL 701


>PNP_LEIXX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 761

 Score = 38.5 bits (88), Expect = 4e-05
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 35  SFGAFVELAGGEQGLVHISQI----AHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           +FGAFV L  G+ GL+HIS++      + V +V D L+ G  + V I   D +G+L L+
Sbjct: 681 AFGAFVSLLPGKDGLLHISEVRKLAGGKRVESVDDVLSIGQKILVEITKIDDRGKLSLA 739


>IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 254

 Score = 38.5 bits (88), Expect = 4e-05
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 17 NVEL--EAGTXXXXXXXXXXSFGA--FVELAGGEQGLVHISQIAHEYVTNVRDYLNEGD- 71
          N++L  E G           +FGA   +E   G +G +HIS++A  +V ++R YL EG  
Sbjct: 2  NIKLLPEVGDLVVVKITEVKNFGANGILEEYPGVEGYIHISEVATGWVKHIRSYLREGQR 61

Query: 72 IVQVLIKGRDAKGRLDLSIK 91
          +V  +I     +  +DLS+K
Sbjct: 62 VVCKVINVNQERKNVDLSLK 81


>RS1_BUCAP RecName: Full=30S ribosomal protein S1;
          Length = 559

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEINVKILKFDKERTRVSLGLKQL 262



 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTN--VRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FG F+ L GG  GLVH+S I+ +      V++Y    +I  V+++    + R+ L IK L
Sbjct: 377 FGIFIGLKGGIDGLVHLSDISWKISGEEAVKNYKKGDEISAVVLQVDAERERISLGIKQL 436


>RR1_PORPU RecName: Full=30S ribosomal protein S1, chloroplastic;
          Length = 263

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +G F++ AG  +GLVHIS+I  + V  +      GD ++ +I   D K GRL LS+K L
Sbjct: 205 YGLFIK-AGNLKGLVHISEINVKQVERIPSQFKIGDTIKAVIIHVDKKQGRLSLSMKHL 262


>PNP_SULMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGR 80
           + GT           FG FV+++   +GL+HI +I+  ++T V  ++ +GDI+ V   G+
Sbjct: 646 KVGTIYKAKVKNIKKFGVFVKISKYLEGLLHIYEIS--WLTKVESFIRKGDIISVKYLGK 703

Query: 81  DAKGR 85
           + K R
Sbjct: 704 NNKFR 708


>PNP_PROM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 38.1 bits (87), Expect = 5e-05
 Identities = 17/58 (29%), Positives = 34/58 (58%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLT 94
           GAFVE+  G++G+VHISQ++                  V ++  D++GR++L+++ ++
Sbjct: 645 GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXXXXXTVRVREIDSRGRINLTLRGVS 702


>RS1_PSEAE RecName: Full=30S ribosomal protein S1;
          Length = 559

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + + +  + +N GD + V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRIKHPSEIVNVGDEIDVKVLKFDRERNRVSLGLKQL 262


>RS1_PROSP RecName: Full=30S ribosomal protein S1;Flags: Fragment;
          Length = 378

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTN--VRDYLNEGDIVQVLIKGRDAKGRLDLSIKDL 93
           FG F+ L GG  GLVH+S I+        VR+Y    +I  V+++    + R+ L +K L
Sbjct: 272 FGIFIGLEGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERERISLGVKQL 331



 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + V ++K    + R+ L +K L
Sbjct: 100 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQL 157


>PNP_PROMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 17/55 (30%), Positives = 32/55 (58%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G+VHISQ++                  V ++  D++GR++L+++
Sbjct: 645 GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXXXXXTVRVREIDSRGRINLTLR 699


>PNP_PROMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 17/55 (30%), Positives = 32/55 (58%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G+VHISQ++                  V ++  D++GR++L+++
Sbjct: 645 GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXXXXXTVRVREIDSRGRINLTLR 699


>PNP_PROM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 17/55 (30%), Positives = 32/55 (58%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G+VHISQ++                  V ++  D++GR++L+++
Sbjct: 645 GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXXXXXTVRVREIDSRGRINLTLR 699


>PNP_PROM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 17/55 (30%), Positives = 32/55 (58%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G+VHISQ++                  V ++  D++GR++L+++
Sbjct: 645 GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXXXXXTVRVREIDSRGRINLTLR 699


>PNP_PROM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 17/55 (30%), Positives = 32/55 (58%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G+VHISQ++                  V ++  D++GR++L+++
Sbjct: 645 GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXXXXXTVRVREIDSRGRINLTLR 699


>PNP_FLAJ1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 36  FGAFVEL--AGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK 83
           FGA VE   A G + L+H+S++A E   NV D +  GD+ +V   G D K
Sbjct: 643 FGAVVEYTAAPGNEVLLHVSELAWERTENVADVVKMGDVFEVKYLGVDPK 692


>PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDY-LNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +GAFVE   G+ GL+HIS+I  + +  V +  + EGD ++V +   D K G+  LS K L
Sbjct: 642 YGAFVEFLPGKDGLLHISEIDWKRLETVEEAGIKEGDEIEVKLIDIDPKTGKFKLSRKVL 701


>PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDY-LNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +GAFVE   G+ GL+HIS+I  + +  V +  + EGD ++V +   D K G+  LS K L
Sbjct: 642 YGAFVEFLPGKDGLLHISEIDWKRLETVEEAGIKEGDEIEVKLIDIDPKTGKFKLSRKVL 701


>PNP_ARCB4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 725

 Score = 37.7 bits (86), Expect = 6e-05
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEG 70
           FGAF+ L  G +GL+HIS+I+ + V NV D L+ G
Sbjct: 670 FGAFILLPKGGEGLLHISKISKDRVKNVADVLSIG 704


>RS1_RHOPA RecName: Full=30S ribosomal protein S1;AltName:
           Full=RRP-S1;
          Length = 565

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIK 78
           LE G            +GAFV+L GG  GL+H++ IA   V +  + L  G  V+V +IK
Sbjct: 198 LEEGQVIDGVVKNITDYGAFVDL-GGIDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIK 256

Query: 79  GRDAKGRLDLSIKDL 93
                 R+ L +K L
Sbjct: 257 INHETHRISLGMKQL 271


>RS1_HAEIN RecName: Full=30S ribosomal protein S1;
          Length = 549

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD V V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEVTVKVLKFDKDRTRVSLGLKQL 262



 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 26/61 (42%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTN--VRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FG F+ L GG  GLVH+S I+        VR Y  +GD V  ++   DA K R+ L IK 
Sbjct: 377 FGIFIGLEGGIDGLVHLSDISWSISGEEAVRQY-KKGDEVSAVVLAVDAVKERISLGIKQ 435

Query: 93  L 93
           L
Sbjct: 436 L 436


>RS1_BUCAI RecName: Full=30S ribosomal protein S1;
          Length = 558

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + + ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEINIKILKFDRERTRVSLGLKQL 262


>PNP_WOLSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 736

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           FGAF+EL  G  GL+H+S+I       + + + EG+ ++V I
Sbjct: 678 FGAFIELPKGGDGLLHVSKIVQHRDQRIDEVIKEGEEIEVQI 719


>PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 697

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            +G FVEL  G+ GL H S++  E   N ++    GD ++V++ 
Sbjct: 625 DIEVGDVFEGKITRIEPYGIFVELMPGKIGLAHSSKLG-EDSKNFKEKYKIGDTIKVIVV 683

Query: 79  GRDAKGRLDL 88
             D  GR+ L
Sbjct: 684 NIDENGRIQL 693


>PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 37.4 bits (85), Expect = 8e-05
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDY-LNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +GAF+E   G+ GL+HIS+I  + +  V +  + EGD ++V +   D K G+  LS K L
Sbjct: 642 YGAFIEFLPGKDGLLHISEIDWKRLETVEEAGIKEGDEIEVKLIDIDPKTGKFKLSRKVL 701


>RS1_SHIFL RecName: Full=30S ribosomal protein S1;
          Length = 557

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQL 262


>RS1_RHIME RecName: Full=30S ribosomal protein S1;
          Length = 568

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIK 78
           LE G            +GAFV+L GG  GL+H++ +A   V +  + LN G  V+V +I+
Sbjct: 195 LEEGQVVEGVVKNITDYGAFVDL-GGIDGLLHVTDMAWRRVNHPSEILNIGQQVKVQIIR 253

Query: 79  GRDAKGRLDLSIKDL 93
                 R+ L +K L
Sbjct: 254 INQETHRISLGMKQL 268


>RS1_ECOLI RecName: Full=30S ribosomal protein S1;
          Length = 557

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQL 262


>RS1_ECOL6 RecName: Full=30S ribosomal protein S1;
          Length = 557

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQL 262


>RS1_ECO57 RecName: Full=30S ribosomal protein S1;
          Length = 557

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIKGRDAKGRLDLSIKDL 93
           +GAFV+L GG  GL+HI+ +A + V +  + +N GD + V ++K    + R+ L +K L
Sbjct: 205 YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFDRERTRVSLGLKQL 262


>PNP_WIGBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 705

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 17/54 (31%), Positives = 31/54 (57%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           FG F  L   ++GL+H+S+I ++  +++ +    G I+ V +   D  GR+ LS
Sbjct: 635 FGIFACLINNKEGLIHVSKIPYKKFSDINNNFKIGQIISVKVIEIDRYGRIRLS 688


>PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 711

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDY-LNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +G FVE   G+ GL+HIS+I  + +  + +  L EGD ++V +   D K G+  LS K L
Sbjct: 642 YGVFVEFLPGKDGLLHISEIDWKRLETIEEAGLKEGDEIEVKLLDIDPKTGKFKLSHKVL 701


>RS1_MYCTU RecName: Full=30S ribosomal protein S1;
          Length = 481

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRD-AKGRLDLSIK 91
           FGAFV +  G +GLVHIS++A  +V      +  GD   V +   D  + R+ LS+K
Sbjct: 307 FGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVIDIDLERRRISLSLK 363


>RS1_MYCLE RecName: Full=30S ribosomal protein S1;
          Length = 481

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRD-AKGRLDLSIK 91
           FGAFV +  G +GLVHIS++A  +V      +  GD   V +   D  + R+ LS+K
Sbjct: 307 FGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVIDIDLERRRISLSLK 363


>PNP_GLUDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/73 (30%), Positives = 29/73 (39%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHIS++A   V                  
Sbjct: 617 EPELGAIYTGKVVKTADFGAFVNFLGARDGLVHISELAQGRVAKTTXXXXXXXXXXXXXL 676

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS++
Sbjct: 677 GFDDRGKVKLSMR 689


>PNP_CHLL2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 736

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 27/61 (44%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 37  GAFVELAGGEQGLVHISQI-AHEYVTNVRDYLNEGD-----IVQVLIKGRDAKGRLDLSI 90
           GAFVE      GLVHIS+I A E V  V D+L  GD     +V V    R  K R  LS+
Sbjct: 657 GAFVEFLPKTDGLVHISEISATERVAKVSDHLKIGDRIKVKLVDVRKDPRTGKTRFALSM 716

Query: 91  K 91
           +
Sbjct: 717 R 717


>PNP_AZOC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 724

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 29/73 (39%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVHISQ++ E V                  
Sbjct: 621 EPEVGAIYDGTVVKVVDFGAFVNFFGSKDGLVHISQLSKERVAXXXXXXXXXXXXXXXXX 680

Query: 79  GRDAKGRLDLSIK 91
             D +G+  LS+K
Sbjct: 681 XFDERGKTRLSMK 693


>PNP_ANAMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 805

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYV 60
           E E G            +GAFV   GG +GLVHIS+I +E++
Sbjct: 623 EPEVGKVFSGVISEIAKYGAFVSFLGGRRGLVHISEIKNEHI 664


>PNP_ANAMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 805

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYV 60
           E E G            +GAFV   GG +GLVHIS+I +E++
Sbjct: 623 EPEVGKVFSGVISEIAKYGAFVSFLGGRRGLVHISEIKNEHI 664


>PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 717

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/73 (30%), Positives = 30/73 (41%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHIS++A   V                + 
Sbjct: 619 EPEVGQIYTGKVVKIADFGAFVNFFGARDGLVHISELAQGRVARXXXXXXXXXXXXXXMI 678

Query: 79  GRDAKGRLDLSIK 91
           G D +G++ LS++
Sbjct: 679 GLDDRGKVKLSMR 691


>IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit
          alpha;AltName: Full=eIF-2-alpha;AltName:
          Full=aIF2-alpha;
          Length = 254

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/60 (36%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 35 SFGA--FVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGR-LDLSIK 91
          +FGA   +E   G +G +HIS++A  +V ++R YL EG  V   + G + + + +DLS+K
Sbjct: 22 NFGANGVLEEYPGVEGYIHISEVATGWVKHIRSYLREGQRVVCKVIGVNPERKVVDLSLK 81


>PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 743

 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRD-YLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +G FVE   G++GL+HIS++  +    + D  L EG+ + V +   D K G+  LS K L
Sbjct: 641 YGCFVEFLPGKEGLLHISEVDWKRFETIEDTNLKEGESINVKLLDIDPKTGKFKLSRKVL 700


>PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 743

 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRD-YLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +G FVE   G++GL+HIS++  +    + D  L EG+ + V +   D K G+  LS K L
Sbjct: 641 YGCFVEFLPGKEGLLHISEVDWKRFETIEDTNLKEGESINVKLLDIDPKTGKFKLSRKVL 700


>RR1_PORYE RecName: Full=30S ribosomal protein S1, chloroplastic;
          Length = 263

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAK-GRLDLSIKDL 93
           +G F+++ G  +GLVHIS+I  + +  +      GD ++ +I   D K GRL LS+K L
Sbjct: 205 YGLFIKV-GNLKGLVHISEINIKNLEQISSQFKIGDTIKAVIIHVDKKQGRLSLSMKHL 262


>PNP_WOLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 755

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 26/59 (44%), Positives = 40/59 (67%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLI 77
           ELE G                +EL  G +G +HIS++A++++ ++   L +GD  + L+
Sbjct: 614 ELEQGAXXXXXXXXXXXXXXELELFNGRKGKMHISEVANQHIESIESILKQGDTFKALV 672


>PNP_SYNJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLS 89
           GAFVE   G++G++HISQ+A   V+                +  D KGR++L+
Sbjct: 643 GAFVEFLPGKEGMIHISQLAEYRVSRXXXXXXXXXXXXXXXRSIDHKGRVNLT 695


>PNP_METSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 20/56 (35%), Positives = 27/56 (48%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV   G + GLVHISQ+A   V    D               D +G++ LS++
Sbjct: 636 FGAFVNFFGSKDGLVHISQLAKGRVAKSSDXXXXXXXXXXXXXXFDDRGKVRLSMR 691


>TEX_BORPE RecName: Full=Protein tex;
          Length = 791

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRD 65
           +FGAFV++   + GLVHIS +A ++V + RD
Sbjct: 682 NFGAFVDIGVHQDGLVHISALAEKFVKDPRD 712


>RS1_NEIMB RecName: Full=30S ribosomal protein S1;
          Length = 561

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 20  LEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQV-LIK 78
           L+ G+           +GAFV+L GG  GL+HI+ +A   V +  + L  G  V+  ++K
Sbjct: 190 LQEGSVIKGIVKNITDYGAFVDL-GGIDGLLHITDLAWRRVKHPSEVLEVGQEVEAKVLK 248

Query: 79  GRDAKGRLDLSIKDL 93
               K R+ L +K L
Sbjct: 249 FDQEKQRVSLGMKQL 263



 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 36  FGAFVELAGGEQGLVHISQIA--HEYVTNVRDYLNEGDIVQVLIKGRDA-KGRLDLSIKD 92
           FG FV L GG  GLVH+S ++        VR Y  +G+ V+ ++   D  K R+ L IK 
Sbjct: 378 FGVFVGLPGGIDGLVHLSDLSWTESGEEAVRKY-KKGEEVEAVVLAIDVEKERISLGIKQ 436

Query: 93  L 93
           L
Sbjct: 437 L 437


>PNP_RHORT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 708

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 21/75 (28%), Positives = 30/75 (40%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHIS+++ +                    
Sbjct: 618 EPEIGVVYTGKVVKIMDFGAFVNFLGTRDGLVHISELSQDRXXXXXXXXXXXXXXXXXXX 677

Query: 79  GRDAKGRLDLSIKDL 93
           G D +G++ LS+K +
Sbjct: 678 GFDDRGKIKLSMKQV 692


>PNP_PARL1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 728

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 24/73 (32%), Positives = 29/73 (39%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G   GLVHISQ+A   V  V               
Sbjct: 619 EPEVGKIYEGTVVKAVDFGAFVNFFGPRDGLVHISQMAPTRVEQVSXXXXXXXXXXXXXX 678

Query: 79  GRDAKGRLDLSIK 91
             D +G++ LS+K
Sbjct: 679 XFDDRGKVRLSMK 691


>PNP_TROWT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 738

 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 36  FGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FG+F+ L  G+ GL+HIS+I       ++ +V + L+ G  V V +   D +G+L L
Sbjct: 678 FGSFISLVPGKDGLLHISEIRKMVDGRHLESVDEVLSVGQKVLVEVSKIDDRGKLCL 734


>PNP_TROW8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 735

 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 36  FGAFVELAGGEQGLVHISQIAH----EYVTNVRDYLNEGDIVQVLIKGRDAKGRLDL 88
           FG+F+ L  G+ GL+HIS+I       ++ +V + L+ G  V V +   D +G+L L
Sbjct: 675 FGSFISLVPGKDGLLHISEIRKMVDGRHLESVDEVLSVGQKVLVEVSKIDDRGKLCL 731


>PNP_STRMK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 21/73 (28%), Positives = 31/73 (42%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ + V                  
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSDRVEXXXXXXXXXXXXXXXXX 678

Query: 79  GRDAKGRLDLSIK 91
               +GR+ LS+K
Sbjct: 679 XXXXQGRIRLSMK 691


>PNP_STRM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 702

 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 21/73 (28%), Positives = 31/73 (42%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           ++E G            FGAFV +  G+ GLVH+SQI+ + V                  
Sbjct: 619 DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSDRVEXXXXXXXXXXXXXXXXX 678

Query: 79  GRDAKGRLDLSIK 91
               +GR+ LS+K
Sbjct: 679 XXXXQGRIRLSMK 691


>PNP_BRAJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 720

 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 23/73 (31%), Positives = 28/73 (38%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           E E G            FGAFV   G + GLVHISQ+A   V                  
Sbjct: 619 EPEVGQIYDGTVVKVMEFGAFVNFFGSKDGLVHISQLASARVQKTSXXXXXXXXXXXXXX 678

Query: 79  GRDAKGRLDLSIK 91
             D +G+  LS+K
Sbjct: 679 XFDDRGKTRLSMK 691


>YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;
          Length = 757

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRD 65
           +L+ G           +FGAFV++   + GLVHIS +++++V + R+
Sbjct: 636 DLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPRE 682


>YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;
          Length = 757

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRD 65
           +L+ G           +FGAFV++   + GLVHIS +++++V + R+
Sbjct: 636 DLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPRE 682


>PRP22_YEAST RecName: Full=Pre-mRNA-splicing factor ATP-dependent
           RNA helicase PRP22;         EC=3.6.1.-;
          Length = 1145

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 35  SFGAFVELAGGEQ----GLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSI 90
           +FG FV++ G       GLVHIS+++ +   +  D + +G  + V +      G++ LS+
Sbjct: 190 TFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKIQNNGKISLSM 249

Query: 91  KDL 93
           K++
Sbjct: 250 KNI 252


>PNP_STRE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 714

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 18/32 (56%), Positives = 19/32 (59%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYL 67
           FGAFV L      LVHIS+IA    TNV D L
Sbjct: 638 FGAFVNLFDKTDALVHISEIAWSRTTNVSDVL 669


>PNP_PROMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 723

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G++HISQ++                    I+  D +GR++L+++
Sbjct: 647 GAFVEILPGKEGMIHISQLSEARXXXXXXXXXXXXXXXXRIREIDNRGRINLTLR 701


>PNP_PROM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 721

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           GAFVE+  G++G++HISQ++                    I+  D +GR++L+++
Sbjct: 645 GAFVEILPGKEGMIHISQLSEARXXXXXXXXXXXXXXXXRIREIDNRGRINLTLR 699


>PNP_HYDS0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 703

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 35  SFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKD 92
           ++G FVE+  G+ GL+H S +  +   NV      GD ++V +   D + RL+L   D
Sbjct: 629 NYGLFVEVLPGKVGLLHASAMTEKPTINV------GDTIKVKVMAIDEQNRLNLCSPD 680


>PNP_ACAM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 716

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 20/71 (28%), Positives = 32/71 (45%)

Query: 19  ELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIK 78
           +L AG             GAFVE+A  ++G++HISQ+A                    I+
Sbjct: 627 KLAAGDVFLGKVTRIIPIGAFVEIAPSKEGMIHISQLADYRXXXXXXXXXXXXXXXXXIR 686

Query: 79  GRDAKGRLDLS 89
             D +GR++L+
Sbjct: 687 ELDNRGRINLT 697


>PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 712

 Score = 33.9 bits (76), Expect = 9e-04
 Identities = 22/73 (30%), Positives = 29/73 (39%)

Query: 21  EAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGR 80
           E G            FGAFV +  G +GL HISQ+  ++V  V D               
Sbjct: 618 EVGAVYEGTVVKIMDFGAFVAILPGTEGLCHISQLDTKHVKKVSDXXXXXXXXXXXXXXL 677

Query: 81  DAKGRLDLSIKDL 93
              G++ LS K L
Sbjct: 678 TKDGKIRLSRKAL 690


>PNP_CHLT3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 729

 Score = 33.9 bits (76), Expect = 9e-04
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 37  GAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGD--IVQVLIKGRDAKG----RLDLSI 90
           GA VE+  G  GL+HIS+++H+  T   D L  G    V+++   +D K     R  LS+
Sbjct: 654 GAIVEILPGVTGLLHISELSHQRGTKPSDILKVGQKTKVKLIRMAKDPKDPRRTRYSLSM 713

Query: 91  KDL 93
           K L
Sbjct: 714 KVL 716


>PNP_BEII9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
                  EC=2.7.7.8;AltName: Full=Polynucleotide
           phosphorylase;         Short=PNPase;
          Length = 715

 Score = 33.9 bits (76), Expect = 9e-04
 Identities = 19/56 (33%), Positives = 26/56 (46%)

Query: 36  FGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIK 91
           FGAFV   G + GLVHISQ+A   V                    D +G++ LS++
Sbjct: 638 FGAFVNFFGSKDGLVHISQLAKGRVAKTSXXXXXXXXXXXXXXXFDDRGKVRLSMR 693


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.316    0.136    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 6,495,776,358
Number of extensions: 254359610
Number of successful extensions: 695443
Number of sequences better than 1.0e-03: 38342
Number of HSP's gapped: 650329
Number of HSP's successfully gapped: 46510
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)