BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAS81963.1 tthe0 pilT.2 GIB00176CH01 "pili retraction protein
pilT"
         (361 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PILT_PSEAE RecName: Full=Twitching mobility protein;                  344   8e-97
PILT_NEIGO RecName: Full=Twitching motility protein;                  298   6e-83
YGGR_ECOLI RecName: Full=Uncharacterized protein yggR;                244   7e-67
HOFB_ECOLI RecName: Full=Protein transport protein hofB;              108   7e-26
GSPE_PSEAE RecName: Full=General secretion pathway protein E;Alt...   107   2e-25
GSPE_XANCP RecName: Full=General secretion pathway protein E;Alt...   104   1e-24
GSPE_KLEPN RecName: Full=General secretion pathway protein E;Alt...   104   1e-24
GSPE_AERHY RecName: Full=General secretion pathway protein E;Alt...   102   4e-24
HOFB_HAEIN RecName: Full=Protein transport protein hofB homolog;      102   7e-24
GSPE_ECOLI RecName: Full=Probable general secretion pathway prot...   102   7e-24
PILF_NEIGO RecName: Full=Type IV pilus assembly protein pilF;         101   1e-23
GSPE_PECCC RecName: Full=General secretion pathway protein E;Alt...   100   2e-23
GSPE_VIBCH RecName: Full=General secretion pathway protein E;Alt...   100   2e-23
TAPB_AERHY RecName: Full=Type IV pilus assembly protein tapB;          99   4e-23
PILB_PSEAE RecName: Full=Type 4 fimbrial assembly protein pilB;        98   1e-22
GSPE1_ERWCH RecName: Full=General secretion pathway protein E;Al...    97   2e-22
COMGA_BACSU RecName: Full=ComG operon protein 1;                       86   4e-19
COMGA_BACHD RecName: Full=ComG operon protein 1 homolog;               84   3e-18
VIRBB_RHIRD RecName: Full=Protein virB11;                              53   5e-09
VIRBB_AGRT9 RecName: Full=Protein virB11;                              53   5e-09
TCPT_VIBCH RecName: Full=Toxin coregulated pilus biosynthesis pr...    52   1e-08
VIRBB_AGRT5 RecName: Full=Protein virB11;                              51   2e-08
TRBB_RHIRD RecName: Full=Conjugal transfer protein trbB;               50   3e-08
TRBB_RHISN RecName: Full=Probable conjugal transfer protein trbB;      49   7e-08
Y1287_METJA RecName: Full=Uncharacterized protein MJ1287;              48   1e-07
Y900_METJA RecName: Full=Uncharacterized protein MJ0900;               45   1e-06
Y781_METJA RecName: Full=Uncharacterized protein MJ0781;Contains...    41   2e-05
VIRBB_BARQU RecName: Full=Type IV secretion system protein virB11;     40   3e-05
VIRBB_BARHE RecName: Full=Type IV secretion system protein virB11;     39   5e-05
VIRBB_BRUSU RecName: Full=Type IV secretion system protein virB11;     39   9e-05
VIRBB_BRUME RecName: Full=Type IV secretion system protein virB11;     39   9e-05
VIRBB_BRUAB RecName: Full=Type IV secretion system protein virB11;     39   9e-05
VIRBB_BRUA2 RecName: Full=Type IV secretion system protein virB11;     39   9e-05
PTLH_BORPE RecName: Full=Type IV secretion system protein ptlH;A...    38   2e-04
PTLH_BORPA RecName: Full=Type IV secretion system protein ptlH h...    38   2e-04
PTLH_BORBR RecName: Full=Type IV secretion system protein ptlH h...    38   2e-04
Y6523_BACAN RecName: Full=Uncharacterized protein pXO2-25/BXB002...    37   4e-04

>PILT_PSEAE RecName: Full=Twitching mobility protein;
          Length = 344

 Score =  344 bits (882), Expect = 8e-97
 Identities = 177/344 (51%), Positives = 233/344 (67%), Gaps = 1/344 (0%)

Query: 6   DVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQR 65
           D+ +LLA + ++GASDL ++ GLPPM+++DG+       PL  ++   L+Y +M++KQ++
Sbjct: 2   DITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRK 61

Query: 66  IFEEEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMS 125
            FEE  E DFSF +PG  R+RVN F Q    G V R +PS V + EELG+ +    ++  
Sbjct: 62  DFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDV 121

Query: 126 PRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSD 185
           PRGLVLVTGPTGSGKSTTLA+M+DY+N  K  HI+TIEDPIEF H+ K+ +VNQRE+  D
Sbjct: 122 PRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRD 181

Query: 186 TKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIV 245
           T  F +ALRS LR+ PD+ILVGEMRD             GHLV GTLHT SA +TIDR+V
Sbjct: 182 TLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVV 241

Query: 246 DVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVRALIREGKTHQ 305
           DVFP  ++  VR  LS +L +V++Q L+ K  GGGRV A+E+MI TPA+R LIRE K  Q
Sbjct: 242 DVFPAEEKAMVRSMLSESLQSVISQTLI-KKIGGGRVAAHEIMIGTPAIRNLIREDKVAQ 300

Query: 306 LRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEF 349
           + S IQTGG  GM T+D CL  L  + LI+ E    +A  P+ F
Sbjct: 301 MYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKIPENF 344


>PILT_NEIGO RecName: Full=Twitching motility protein;
          Length = 374

 Score =  298 bits (762), Expect = 6e-83
 Identities = 157/314 (50%), Positives = 205/314 (65%)

Query: 30  PMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEEKELDFSFSLPGKGRYRVNV 89
           PM+++ G+        ++ +E   ++ ++M++ Q++I+++  E+DFSF LP   R+RVN 
Sbjct: 53  PMIRVHGDMRRINLPEMSAEEVGNMVTSVMNDHQRKIYQQNLEVDFSFELPNVARFRVNA 112

Query: 90  FLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMID 149
           F        V R +PS V S EEL  P    +IA SPRG+VLVTGPTGSGKSTTLA+MI+
Sbjct: 113 FNTGRGPAAVFRTIPSTVLSLEELKAPSIFQKIAESPRGMVLVTGPTGSGKSTTLAAMIN 172

Query: 150 YINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEM 209
           YINE +  HI+TIEDPIEF H+ K++++NQRE+   T SF  AL S LR+ PDVILVGEM
Sbjct: 173 YINETQPAHILTIEDPIEFVHQSKKSLINQRELHQHTLSFANALSSALREDPDVILVGEM 232

Query: 210 RDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLT 269
           RD             GHLV GTLHT  A +T+DRIVDVFP  ++E VR  LS +L AV++
Sbjct: 233 RDPETIGLALTAAETGHLVFGTLHTTGAAKTVDRIVDVFPAGEKEMVRSMLSESLTAVIS 292

Query: 270 QQLLPKAFGGGRVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLY 329
           Q LL    G GRV ++E++IA PAVR LIRE K  Q+ SV+QTG   GM TMD  L  L 
Sbjct: 293 QNLLKTHDGNGRVASHEILIANPAVRNLIRENKITQINSVLQTGQASGMQTMDQSLQSLV 352

Query: 330 RRKLITYEMGLARA 343
           R+ LI  E    RA
Sbjct: 353 RQGLIAPEAARRRA 366


>YGGR_ECOLI RecName: Full=Uncharacterized protein yggR;
          Length = 326

 Score =  244 bits (624), Expect = 7e-67
 Identities = 136/312 (43%), Positives = 189/312 (60%), Gaps = 4/312 (1%)

Query: 9   DLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFE 68
           +++AL+V+   SDL +    P   +I G     E  P    +   L+   +D+ Q+ I  
Sbjct: 5   EIVALSVKHNVSDLHLCSAWPARWRIRGRM---EAAPFDTPDVEELLREWLDDDQRAILL 61

Query: 69  EEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRG 128
           E  +LDF+ SL    R R + F QR  +   LR++PS     E+LG P  + E+  S  G
Sbjct: 62  ENGQLDFAVSLAENQRLRGSAFAQRHGISLALRLLPSHCPQLEQLGAPTVLPELLKSENG 121

Query: 129 LVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKS 188
           L+LVTG TGSGKSTTLA+M+ Y+N+    HI+T+EDP+E+ +  +R ++ QREIG    +
Sbjct: 122 LILVTGATGSGKSTTLAAMVGYLNQHADAHILTLEDPVEYLYASQRCLIQQREIGLHCMT 181

Query: 189 FHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVF 248
           F   LR+ LR+ PDVIL+GE+RD             GHLV+ TLHT  A + ++R+VD F
Sbjct: 182 FASGLRAALREDPDVILLGELRDSETIRLALTAAETGHLVLATLHTRGAAQAVERLVDSF 241

Query: 249 PENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVRALIREGKTHQLRS 308
           P  +++ VR QL+ +L AVL+Q+L       GRV  +EL+I TPAV  LIREGKTHQL  
Sbjct: 242 PAQEKDPVRNQLAGSLRAVLSQKLEVDK-QEGRVALFELLINTPAVGNLIREGKTHQLPH 300

Query: 309 VIQTGGQYGMIT 320
           VIQTG Q GMIT
Sbjct: 301 VIQTGQQVGMIT 312


>HOFB_ECOLI RecName: Full=Protein transport protein hofB;
          Length = 461

 Score =  108 bits (270), Expect = 7e-26
 Identities = 122/407 (29%), Positives = 177/407 (43%), Gaps = 78/407 (19%)

Query: 3   KAPDVVDLLALAVERGASDLVITVG---LPPMLKIDGEFHPTEYEPLTPQETRRLMYALM 59
           KA  +   L  A+E+ ASD+ I          L+IDG  HP     ++P     L   L 
Sbjct: 81  KAELLTRTLQSALEQRASDIHIEPADNAYRIRLRIDGVLHPLP--DVSPDAGVALTARLK 138

Query: 60  DEKQQRIFEEEKELDFSFSLPGKGR---YRVNVFLQRGSVGGVLRVVPSAVKSFE--ELG 114
                 I E     D  F++   G    +R+     RG    VLR++    ++ +   LG
Sbjct: 139 VLGNLDIAEHRLPQDGQFTVELAGNAVSFRIATLPCRGGEKVVLRLLQQVGQALDVNTLG 198

Query: 115 L-PKNIAEIA---MSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFH 170
           + P  +A+ A     P+GLVLVTGPTGSGK+ TL S +  +N     +I ++EDP+E   
Sbjct: 199 MQPLQLADFAHALQQPQGLVLVTGPTGSGKTVTLYSALQKLNTADI-NICSVEDPVEI-- 255

Query: 171 KHKRAIVNQREIGSDTK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVM 229
               A +NQ +I      +F   LR++LRQ PDVI++GE+RD             GHLV+
Sbjct: 256 --PIAGLNQTQIHPRAGLTFQGVLRALLRQDPDVIMIGEIRDGETAEIAIKAAQTGHLVL 313

Query: 230 GTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPK-------------- 275
            TLHTNS  ET+ R+       Q    R  LS+ L  V+ Q+L+ K              
Sbjct: 314 STLHTNSTCETLVRL------QQMGVARWMLSSALTLVIAQRLVRKLCPHCRRQQGEPIH 367

Query: 276 --------------------AFGG--GRVLAYELMIATPAVRALIREGKTHQLRSVIQTG 313
                                + G  GR   +E++  TP +R LI       + S+    
Sbjct: 368 IPDNVWPSPLPHWQAPGCVHCYHGFYGRTALFEVLPITPVIRQLI--SANTDVESLETHA 425

Query: 314 GQYGMITM--DACLADLYRRKLITYEMGLARAVDPKEFMRLAGAPEG 358
            Q GM T+  + CLA    + L T+E          E +R+ G P G
Sbjct: 426 RQAGMRTLFENGCLA--VEQGLTTFE----------ELIRVLGMPHG 460


>GSPE_PSEAE RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;
          Length = 502

 Score =  107 bits (267), Expect = 2e-25
 Identities = 90/278 (32%), Positives = 136/278 (48%), Gaps = 28/278 (10%)

Query: 10  LLALAVERGASDLVITV---GLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRI 66
           +L  A+   ASD+ +      L    ++DG       E L P+     +     +   R+
Sbjct: 129 ILGEAIRENASDIHLETFEKRLVVRFRVDGVLR----EVLEPKRELAALLVSRIKVMARL 184

Query: 67  FEEEKEL--DFSFSLPGKGR---YRVNVFLQRGSVGGVLRVVPSAVK--SFEELGLP--- 116
              EK +  D   SL   GR    RV+          VLR++       + + LG+    
Sbjct: 185 DIAEKRIPQDGRISLRVGGREVDIRVSTLPSANGERVVLRLLDKQAGRLNLQHLGMSERD 244

Query: 117 -KNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRA 175
            K + E    P G++LVTGPTGSGK+TTL + +  +N+R   +I+T+EDPIE+   H   
Sbjct: 245 RKLMDETVRKPHGILLVTGPTGSGKTTTLYASLTTLNDRTR-NILTVEDPIEY---HLEG 300

Query: 176 IVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTN 235
           I   +       +F + LR++LRQ PDV++VGE+RD             GHLV+ TLHTN
Sbjct: 301 IGQTQVNAKVDMTFARGLRAILRQDPDVVMVGEIRDRETAEIAVQASLTGHLVLSTLHTN 360

Query: 236 SAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
           SA   I R+VD+  E         LS++++ VL Q+L+
Sbjct: 361 SAIGAITRLVDMGIE------PFLLSSSMLGVLAQRLV 392


>GSPE_XANCP RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;
          Length = 567

 Score =  104 bits (260), Expect = 1e-24
 Identities = 64/166 (38%), Positives = 97/166 (58%), Gaps = 11/166 (6%)

Query: 110 FEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFF 169
           F E  LP+   ++   P G++LVTGPTGSGK+TTL + +  +N      I+T+EDP+E+ 
Sbjct: 302 FTEDFLPQ-FRKVLEQPHGIMLVTGPTGSGKTTTLYTALSQLNTSDV-KIITVEDPVEYQ 359

Query: 170 HKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVM 229
            +    I  + +IG D   F  ALRS++RQ PD+I++GEMRD             GHLV+
Sbjct: 360 IEGINQIQAKPQIGLD---FANALRSIVRQDPDIIMIGEMRDLETARIAIQSALTGHLVL 416

Query: 230 GTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPK 275
            TLHTN+A   I R++D+  E+        L++ +  +L Q+L+ K
Sbjct: 417 STLHTNNAAGGITRLLDMGVED------YLLTSTINGILAQRLVRK 456


>GSPE_KLEPN RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;AltName:
           Full=Pullulanase secretion protein pulE;
          Length = 497

 Score =  104 bits (259), Expect = 1e-24
 Identities = 65/160 (40%), Positives = 97/160 (60%), Gaps = 12/160 (7%)

Query: 115 LPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKR 174
           L + +  +   P G+VLVTGPTGSGKSTTL + +  ++ R+  +I+TIEDPIE+    + 
Sbjct: 236 LLRQVDGLIARPHGIVLVTGPTGSGKSTTLYAALSRLDARER-NIMTIEDPIEY----EL 290

Query: 175 AIVNQREIGSDTK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLH 233
             + Q ++ +    +F + LR++LRQ PDV+LVGE+RD             GHLV+ TLH
Sbjct: 291 EGIGQTQVNAKVDMTFARGLRAILRQDPDVVLVGEIRDGETAQIAVQASLTGHLVLSTLH 350

Query: 234 TNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
           TNSA   I R+ D+  E         LS +L+AV++Q+L+
Sbjct: 351 TNSALGAISRLQDMGVE------PFLLSTSLLAVMSQRLV 384


>GSPE_AERHY RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;
          Length = 501

 Score =  102 bits (255), Expect = 4e-24
 Identities = 58/130 (44%), Positives = 82/130 (63%), Gaps = 6/130 (4%)

Query: 119 IAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVN 178
           I+E+   P G++LVTGPTGSGKSTTL + +  IN R   +I+T+EDPIE+  +     V 
Sbjct: 247 ISELIRKPHGIILVTGPTGSGKSTTLYAALSEINSRDR-NILTVEDPIEYDLEG----VG 301

Query: 179 QREIGSDTK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSA 237
           Q ++ +    +F + LR++LRQ PDV++VGE+RD             GHLVM TLHTN+A
Sbjct: 302 QTQVNTKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTA 361

Query: 238 PETIDRIVDV 247
              I R+ D+
Sbjct: 362 IGAITRMRDM 371


>HOFB_HAEIN RecName: Full=Protein transport protein hofB homolog;
          Length = 464

 Score =  102 bits (253), Expect = 7e-24
 Identities = 66/174 (37%), Positives = 97/174 (55%), Gaps = 20/174 (11%)

Query: 109 SFEELGLPKN----IAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIED 164
           SF ELG+ +N       +   P+GL+LVTGPTGSGKS +L + + ++N     HI+T ED
Sbjct: 235 SFSELGMTENQQQAFQRVLSQPQGLILVTGPTGSGKSISLYTALQWLNTPDK-HIMTAED 293

Query: 165 PIEFFHKHKRAIVNQR---EIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXX 221
           PIE        I+  +   +IG D   F++ LR+ LRQ PD+I++GE+RD          
Sbjct: 294 PIEI---ELDGIIQSQINPQIGLD---FNRLLRTFLRQDPDIIMLGEIRDEESAMIALRA 347

Query: 222 XXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPK 275
              GHLV+ TLHTN A   I R+       Q    + ++ N+L+ V+ Q+L+ K
Sbjct: 348 AQTGHLVLSTLHTNDAISAISRL------QQLGIQQYEIKNSLLLVIAQRLVRK 395


>GSPE_ECOLI RecName: Full=Probable general secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;
          Length = 493

 Score =  102 bits (253), Expect = 7e-24
 Identities = 73/223 (32%), Positives = 117/223 (52%), Gaps = 23/223 (10%)

Query: 117 KNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAI 176
           +++  +   P G++LVTGPTGSGKSTTL +++  +N     +I+T+EDP+E+    +   
Sbjct: 232 QDLENLIQLPHGIILVTGPTGSGKSTTLYAILSALNT-PGRNILTVEDPVEY----ELEG 286

Query: 177 VNQREIGSDTK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTN 235
           + Q ++ +    SF + LR++LRQ PDV++VGE+RD             GHLV+ TLHTN
Sbjct: 287 IGQTQVNTRVDMSFARGLRAILRQDPDVVMVGEIRDTETAQIAVQASLTGHLVLSTLHTN 346

Query: 236 SAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVR 295
           SA   + R+ D+  E+        LS++L  ++ Q+L+       R L  +    TP   
Sbjct: 347 SASGAVTRLRDMGVES------FLLSSSLAGIIAQRLV-------RRLCPQCRQFTPVSP 393

Query: 296 ALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEM 338
              +  K HQL +V   G   G      C    Y+ ++  +EM
Sbjct: 394 QQAQMFKYHQL-AVTTIGTPVG---CPHCHQSGYQGRMAIHEM 432


>PILF_NEIGO RecName: Full=Type IV pilus assembly protein pilF;
          Length = 558

 Score =  101 bits (251), Expect = 1e-23
 Identities = 94/344 (27%), Positives = 163/344 (47%), Gaps = 37/344 (10%)

Query: 11  LALAVERGASDLVITV---GLPPMLKIDGEFHPTEYEPLTPQ---ETRRLMYALMDEKQQ 64
           L+ A+  GASD+             ++DG+       P+  +    +R  + + +D  ++
Sbjct: 180 LSDALRSGASDIHFEFYEHNARIRFRVDGQLREVVQPPIAVRGQLASRIKVMSRLDISEK 239

Query: 65  RIFEEEKELDFSFSLPGKG-RYRVNVFLQRGSVGGVLRVVPSAVKSF--EELGLP----K 117
           RI  ++  +  +F   GK   +RV+          V+R++ S   S   ++LG      K
Sbjct: 240 RI-PQDGRMQLTFQKGGKPVDFRVSTLPTLFGEKVVMRILNSDAASLNIDQLGFEPFQKK 298

Query: 118 NIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIV 177
            + E    P G+VLVTGPTGSGK+ +L + ++ +N  ++ +I T EDP E         +
Sbjct: 299 LLLEAIHRPYGMVLVTGPTGSGKTVSLYTCLNILNT-ESVNIATAEDPAEI----NLPGI 353

Query: 178 NQREIGSDTK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNS 236
           NQ  +      +F  AL+S LRQ PD+I+VGE+RD             GH+V  TLHTN+
Sbjct: 354 NQVNVNDKQGLTFAAALKSFLRQDPDIIMVGEIRDLETADIAIKAAQTGHMVFSTLHTNN 413

Query: 237 APETIDRIVD--VFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAV 294
           AP T+ R+++  V P N        +++++  ++ Q+LL +        + +  +  P+ 
Sbjct: 414 APATLSRMLNMGVAPFN--------IASSVSLIMAQRLLRRLCS-----SCKQEVERPSA 460

Query: 295 RALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEM 338
            AL   G T +   + +    YG +  D C    Y+ +   YE+
Sbjct: 461 SALKEVGFTDE--DLAKDWKLYGAVGCDRCRGQGYKGRAGVYEV 502


>GSPE_PECCC RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;AltName:
           Full=Pectic enzymes secretion protein outE;
          Length = 498

 Score =  100 bits (250), Expect = 2e-23
 Identities = 61/149 (40%), Positives = 90/149 (60%), Gaps = 12/149 (8%)

Query: 126 PRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSD 185
           P G++LVTGPTGSGKSTTL + +  +N  +  +I+T+EDPIE+    +   + Q ++ + 
Sbjct: 253 PHGIILVTGPTGSGKSTTLYAALSRLNASER-NIMTVEDPIEY----ELEGIGQTQVNTK 307

Query: 186 TK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRI 244
              +F + LR++LRQ PDV+LVGE+RD             GHLV+ TLHTNSA   + R+
Sbjct: 308 VDMTFARGLRAILRQDPDVVLVGEIRDGETAQIAVQASLTGHLVLSTLHTNSALGALSRL 367

Query: 245 VDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
            D+  E         LS +L+ VL Q+L+
Sbjct: 368 QDMGVE------PFLLSTSLLGVLAQRLV 390


>GSPE_VIBCH RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;AltName:
           Full=Cholera toxin secretion protein epsE;
          Length = 503

 Score =  100 bits (249), Expect = 2e-23
 Identities = 63/157 (40%), Positives = 91/157 (57%), Gaps = 12/157 (7%)

Query: 118 NIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF-FHKHKRAI 176
           N   +   P G++LVTGPTGSGKSTTL + +  +N  +  +I+T+EDPIEF      +  
Sbjct: 248 NFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSER-NILTVEDPIEFDIDGIGQTQ 306

Query: 177 VNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNS 236
           VN R       +F + LR++LRQ PDV++VGE+RD             GHLVM TLHTN+
Sbjct: 307 VNPRV----DMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNT 362

Query: 237 APETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
           A   + R+ D+  E         +S++L+ VL Q+L+
Sbjct: 363 AVGAVTRLRDMGIE------PFLISSSLLGVLAQRLV 393


>TAPB_AERHY RecName: Full=Type IV pilus assembly protein tapB;
          Length = 568

 Score = 99.4 bits (246), Expect = 4e-23
 Identities = 79/246 (32%), Positives = 119/246 (48%), Gaps = 17/246 (6%)

Query: 14  AVERGASDLVIT---VGLPPMLKIDGEFHPTEYEP--LTPQETRRLMYALMDEKQQRIFE 68
           A++RGASDL             +IDG  H     P  L  + + RL      +  +R   
Sbjct: 196 AIKRGASDLHFEPYETKYRIRFRIDGILHEIATPPVNLANRFSARLKVMARLDIAERRLP 255

Query: 69  EEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVK--SFEELGLPKN----IAEI 122
           ++  +    S       RVN          V+R++ S+    + E+LG            
Sbjct: 256 QDGRIKLKLSRNKSMDMRVNTLPTMWGEKIVIRLLDSSAARLNIEQLGFDDRQKAQYLRA 315

Query: 123 AMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREI 182
              P+G++LVTGPTGSGK+ +L + ++ +N  +  +I T EDP+E         VNQ ++
Sbjct: 316 LSKPQGMILVTGPTGSGKTVSLYTGLNILNTTEV-NISTAEDPVEI----NLPGVNQVQV 370

Query: 183 GSDTK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETI 241
                 +F  ALRS LRQ PDV++VGE+RD             GHLV+ TLHTNSA ET+
Sbjct: 371 NPKAGLTFASALRSFLRQDPDVVMVGEIRDLETAEIAIKAAQTGHLVLSTLHTNSAAETL 430

Query: 242 DRIVDV 247
            R++++
Sbjct: 431 TRMMNM 436


>PILB_PSEAE RecName: Full=Type 4 fimbrial assembly protein pilB;
          Length = 566

 Score = 97.8 bits (242), Expect = 1e-22
 Identities = 83/254 (32%), Positives = 127/254 (50%), Gaps = 25/254 (9%)

Query: 10  LLALAVERGASDLVITVGLPPMLKI-------DGEFHPTEYEP--LTPQETRRLMYALMD 60
           +L  A++ G+SDL       P  KI       DG  H     P  L  + + RL      
Sbjct: 191 MLLDAIKGGSSDL----HFEPYEKIYRVRFRTDGMLHEVAKPPIQLASRISARLKVMAGL 246

Query: 61  EKQQRIFEEEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPS--AVKSFEELGLPKN 118
           +  +R   ++  +    S      +RVN          V+R++ S  A    + LG  ++
Sbjct: 247 DISERRKPQDGRIKMRVSKTKSIDFRVNTLPTLWGEKIVMRILDSSSAQMGIDALGYEED 306

Query: 119 IAEIAMS----PRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF-FHKHK 173
             E+ ++    P+G++LVTGPTGSGK+ +L + ++ +N     +I T EDP+E       
Sbjct: 307 QKELYLAALKQPQGMILVTGPTGSGKTVSLYTGLNILNTTDI-NISTAEDPVEINLEGIN 365

Query: 174 RAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLH 233
           +  VN R+ G D   F +ALR+ LRQ PDVI+VGE+RD             GH+VM TLH
Sbjct: 366 QVNVNPRQ-GMD---FSQALRAFLRQDPDVIMVGEIRDLETAEIAIKAAQTGHMVMSTLH 421

Query: 234 TNSAPETIDRIVDV 247
           TNSA ET+ R++++
Sbjct: 422 TNSAAETLTRLLNM 435


>GSPE1_ERWCH RecName: Full=General secretion pathway protein
           E;AltName: Full=Type II traffic warden ATPase;AltName:
           Full=Pectic enzymes secretion protein outE;
          Length = 498

 Score = 97.4 bits (241), Expect = 2e-22
 Identities = 60/149 (40%), Positives = 88/149 (59%), Gaps = 12/149 (8%)

Query: 126 PRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSD 185
           P G++LVTGPT SGKSTTL + +  +N  +  +I+T+EDPIE+    +   + Q ++   
Sbjct: 253 PHGIILVTGPTASGKSTTLYAALSPLNSAER-NIMTVEDPIEY----ELEGIGQTQVNPK 307

Query: 186 TK-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRI 244
              +F + LR++LRQ PDV+LVGE+RD             GHLV+ TLHTNSA   + R+
Sbjct: 308 VDMTFARGLRAILRQDPDVVLVGEIRDGETAQIAVQASLTGHLVLSTLHTNSALGALSRL 367

Query: 245 VDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
            D+  E         LS +L+ VL Q+L+
Sbjct: 368 QDMGIE------PFLLSTSLLGVLAQRLV 390


>COMGA_BACSU RecName: Full=ComG operon protein 1;
          Length = 356

 Score = 86.3 bits (212), Expect = 4e-19
 Identities = 59/183 (32%), Positives = 98/183 (53%), Gaps = 14/183 (7%)

Query: 99  VLRVVPSA-VKSFEELGL-PKNIAEIAM---SPRGLVLVTGPTGSGKSTTLASMIDYINE 153
           V+RV+P   + S ++L L PK  A +        G+++ TGPTGSGK+TTL S++ Y  +
Sbjct: 104 VIRVMPQYNIPSIDKLSLFPKTGATLLSFLKHSHGMLIFTGPTGSGKTTTLYSLVQYAKK 163

Query: 154 RKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYX 213
               +IVT+EDP+E   +    +    + G    ++   L+++LR  PD+I++GE+RD  
Sbjct: 164 HFNRNIVTLEDPVETRDEDVLQVQVNEKAG---VTYSAGLKAILRHDPDMIILGEIRDAE 220

Query: 214 XXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
                      GHLV+ +LHT  A   I R+++ F  N  E     +   ++A+  Q+L+
Sbjct: 221 TAEIAVRAAMTGHLVLTSLHTRDAKGAIYRLLE-FGINMNE-----IEQTVIAIAAQRLV 274

Query: 274 PKA 276
             A
Sbjct: 275 DLA 277


>COMGA_BACHD RecName: Full=ComG operon protein 1 homolog;
          Length = 348

 Score = 83.6 bits (205), Expect = 3e-18
 Identities = 52/150 (34%), Positives = 81/150 (54%), Gaps = 11/150 (7%)

Query: 127 RGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDT 186
           +GL+L+TG TGSGK+TTL +M+      +  HIVTIEDPIE           Q E+    
Sbjct: 138 QGLILLTGATGSGKTTTLYAMLQKALHMQNLHIVTIEDPIE----QLNPAFTQFEMNEKA 193

Query: 187 K-SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIV 245
           + ++   L++ LR  PDVI++GE+RD             GHLV+ T+H+ +A  TI R+ 
Sbjct: 194 QLTYEVGLKAALRHDPDVIMIGEIRDQTTAVYAVRAALTGHLVLATIHSANARGTITRLC 253

Query: 246 DVFPENQQEQVRVQLSNNLVAVLTQQLLPK 275
           ++            L   +VA++ Q+L+ +
Sbjct: 254 EM------GVALHDLREVVVAIIAQELISR 277


>VIRBB_RHIRD RecName: Full=Protein virB11;
          Length = 343

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFF---HKHKRAIVNQREIGSDT 186
           +L+ GPTGSGK+T   ++I  I  ++   ++TIED +E       H R + ++   G   
Sbjct: 165 MLLCGPTGSGKTTMSKTLISAIPPQE--RLITIEDTLELVIPHDNHVRLLYSKNGAGLGA 222

Query: 187 KSFHKALRSVLRQAPDVILVGEMRD 211
            S    L++ LR  PD IL+GEMRD
Sbjct: 223 VSAEHLLQASLRMRPDRILLGEMRD 247


>VIRBB_AGRT9 RecName: Full=Protein virB11;
          Length = 343

 Score = 52.8 bits (125), Expect = 5e-09
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFF---HKHKRAIVNQREIGSDT 186
           +L+ GPTGSGK+T   ++I  I  ++   ++TIED +E       H R + ++   G   
Sbjct: 165 MLLCGPTGSGKTTMSKTLISAIPPQE--RLITIEDTLELVIPHDNHVRLLYSKNGAGLGA 222

Query: 187 KSFHKALRSVLRQAPDVILVGEMRD 211
            S    L++ LR  PD IL+GEMRD
Sbjct: 223 VSAEHLLQASLRMRPDRILLGEMRD 247


>TCPT_VIBCH RecName: Full=Toxin coregulated pilus biosynthesis
           protein T;AltName: Full=TCP pilus biosynthesis protein
           tcpT;
          Length = 503

 Score = 51.6 bits (122), Expect = 1e-08
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 6/122 (4%)

Query: 155 KACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKS-FHKALRSVLRQAPDVILVGEMRDYX 213
           K C  VT+EDP+E+     +      +    TK+ F  A+RS +R+ PDVI++GE+RD  
Sbjct: 261 KGC-FVTVEDPVEYLISGAQQSSIVADNDDKTKNPFADAVRSAMRRDPDVIMIGEIRDKP 319

Query: 214 XXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLL 273
                      GH  + T+H  S    + R+  +      +  ++     L  + +Q+L+
Sbjct: 320 TVEALSSAVESGHYCLTTIHAGSVVSVLQRLSGL----GMKADKIASPGFLAGITSQKLI 375

Query: 274 PK 275
           P+
Sbjct: 376 PE 377


>VIRBB_AGRT5 RecName: Full=Protein virB11;
          Length = 344

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 5/85 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFF---HKHKRAIVNQREIGSDT 186
           +L+ GPTGSGK+T   ++I+ I  ++   ++TIED +E       H R + ++   G   
Sbjct: 165 MLLCGPTGSGKTTMSKTLINAIPPQE--RLITIEDTLELVIPHENHVRLLYSKNGAGLGA 222

Query: 187 KSFHKALRSVLRQAPDVILVGEMRD 211
            +    L++ LR  PD IL+GE+RD
Sbjct: 223 VTAEHLLQASLRMRPDRILLGEIRD 247


>TRBB_RHIRD RecName: Full=Conjugal transfer protein trbB;
          Length = 323

 Score = 50.1 bits (118), Expect = 3e-08
 Identities = 51/194 (26%), Positives = 82/194 (42%), Gaps = 33/194 (17%)

Query: 123 AMSPRGLVLVTGPTGSGKSTTLASMI--DYINERKACHIVTIEDPIEFFHKHKRAIVNQR 180
           A+  R  ++++G TGSGK TTLA+ I  + +       +V +ED  E     + A+    
Sbjct: 140 AIDSRMNIVISGGTGSGK-TTLANAIIAEIVTAAPDDRLVILEDTAEIQCAAENAVSLHT 198

Query: 181 EIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPET 240
              SDT    + L+S +R  PD I+VGE+RD                 + T+H+N+A   
Sbjct: 199 ---SDTVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGHPGGVTTIHSNTALSA 255

Query: 241 IDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVRALIRE 300
           + R+                   L A  +QQL+ +  G           A   + ++ R 
Sbjct: 256 LRRL-----------------EQLTAEASQQLMQEVIGE----------AVDLIVSIERS 288

Query: 301 GKTHQLRSVIQTGG 314
           GK  ++R VI   G
Sbjct: 289 GKGRRVREVIHIEG 302


>TRBB_RHISN RecName: Full=Probable conjugal transfer protein trbB;
          Length = 325

 Score = 48.9 bits (115), Expect = 7e-08
 Identities = 36/154 (23%), Positives = 72/154 (46%), Gaps = 4/154 (2%)

Query: 123 AMSPRGLVLVTGPTGSGKSTTLASMI-DYINERKACHIVTIEDPIEFFHKHKRAIVNQRE 181
           A+  R  ++++G T SGK+T   ++I + +       +V +ED  E       A++ +  
Sbjct: 140 AIDSRLNIIISGGTASGKTTLANAVIHEIVRSAPEDRLVILEDTAEIQCAADNAVLLRT- 198

Query: 182 IGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETI 241
             SDT    + L+S +R  PD I+VGE+RD                 + T+H+N+A   +
Sbjct: 199 --SDTVDMARLLKSTMRLRPDRIVVGEVRDGAALTLLKAWNTGHPGGVATIHSNTATSAL 256

Query: 242 DRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPK 275
            R+  +  E  Q+ +   +   +  +++ +  P+
Sbjct: 257 RRLEQLTAEASQQPMHEVIGEVVDLIVSIERTPR 290


>Y1287_METJA RecName: Full=Uncharacterized protein MJ1287;
          Length = 270

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 39/136 (28%), Positives = 63/136 (46%), Gaps = 8/136 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSF 189
           ++V G   +GK+T L +   +I  +    IV+IED  E    H+  I      G   + +
Sbjct: 29  IMVAGEVATGKTTLLNAFSLFIPPQMK--IVSIEDTPEIRLYHENWIAGTTRSGFGGEEY 86

Query: 190 H----KALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIV 245
                  L++ LRQ PD ++VGE+R              GHL + T+H  S PE + R +
Sbjct: 87  EITMMDLLKAALRQRPDYLIVGEVRG-EEAKILFQAITTGHLALSTIHAKS-PEAVIRRL 144

Query: 246 DVFPENQQEQVRVQLS 261
           +  P N  + +  QL+
Sbjct: 145 NAEPMNIPKIMLEQLN 160


>Y900_METJA RecName: Full=Uncharacterized protein MJ0900;
          Length = 551

 Score = 45.1 bits (105), Expect = 1e-06
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 6/118 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKH---KRAIVNQREIGSDT 186
           + + G T SGK+TTL +++ +I       I + ED  E    H   ++ +  +R      
Sbjct: 301 IFICGETASGKTTTLNAILPFIKPNS--KIFSCEDTPEVKPPHPVWQQLVTRERGPEESR 358

Query: 187 KSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRI 244
            +    LR+ LR  P+ I+VGE+R              GH V+ T H  +  + I R+
Sbjct: 359 VTLFDLLRAALRSRPNYIIVGEIRS-VEAAVAFQAMQTGHPVLSTFHAANVRKMIQRL 415


>Y781_METJA RecName: Full=Uncharacterized protein MJ0781;Contains:
           RecName: Full=Mja klbA intein;
          Length = 721

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 33/92 (35%), Positives = 44/92 (47%), Gaps = 21/92 (22%)

Query: 131 LVTGPTGSGKSTTL--ASMIDYINERKACHIVTIEDPIEFFHKHKRAI----------VN 178
           L+ G TGSGK+T L   S+    NER    I+TIED  E    HK  I          + 
Sbjct: 305 LIAGGTGSGKTTLLNVLSLFSMYNER----IITIEDTPELQIPHKHVIKMVTRPARPGMP 360

Query: 179 QREIGSDTKSFHKALRSVLRQAPDVILVGEMR 210
           + E+  D       +++ LR  PD I VGE+R
Sbjct: 361 EYEVTMDD-----LIKNALRMRPDRIFVGEVR 387


>VIRBB_BARQU RecName: Full=Type IV secretion system protein virB11;
          Length = 356

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFF---HKHKRAIVNQREIGSDT 186
           +L+ G TGSGK+T   ++I  I + +   I+TIED  E       +   I ++   G  +
Sbjct: 183 ILIAGKTGSGKTTLSKALIAKIPDNE--RIITIEDTPELVVPQPNYVSMIYSKDGQGLAS 240

Query: 187 KSFHKALRSVLRQAPDVILVGEMRD 211
               + L S LR  PD IL+ E+RD
Sbjct: 241 VGPKELLESALRMRPDRILLQELRD 265


>VIRBB_BARHE RecName: Full=Type IV secretion system protein virB11;
          Length = 356

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFF---HKHKRAIVNQREIGSDT 186
           +L+ G TGSGK+T   ++I  I + +   I+TIED  E       +   I ++   G  +
Sbjct: 183 ILIAGKTGSGKTTLSKALIAKIPDDE--RIITIEDTPELVVPQPNYVSMIYSKDGQGLAS 240

Query: 187 KSFHKALRSVLRQAPDVILVGEMRD 211
               + L S LR  PD IL+ E+RD
Sbjct: 241 VGPKELLESALRMRPDRILLQELRD 265


>VIRBB_BRUSU RecName: Full=Type IV secretion system protein virB11;
          Length = 361

 Score = 38.5 bits (88), Expect = 9e-05
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 109 SFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF 168
           + +E G   +    A+    +++V G TGSGK+T + +++  I   +   ++TIED  E 
Sbjct: 157 ALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQ--RLITIEDVPEL 214

Query: 169 F------HKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXX 222
           F      H H       +E  +   +    LRS LR  P  IL+ E+R            
Sbjct: 215 FLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAA 274

Query: 223 XXGHLVMGTLHTNSAPETIDRIVDVFPENQQ 253
                 + + H  S   T +R+  +  +N+Q
Sbjct: 275 SGHGGSITSCHAGSCELTFERLALMVLQNRQ 305


>VIRBB_BRUME RecName: Full=Type IV secretion system protein virB11;
          Length = 362

 Score = 38.5 bits (88), Expect = 9e-05
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 109 SFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF 168
           + +E G   +    A+    +++V G TGSGK+T + +++  I   +   ++TIED  E 
Sbjct: 157 ALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQ--RLITIEDVPEL 214

Query: 169 F------HKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXX 222
           F      H H       +E  +   +    LRS LR  P  IL+ E+R            
Sbjct: 215 FLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAA 274

Query: 223 XXGHLVMGTLHTNSAPETIDRIVDVFPENQQ 253
                 + + H  S   T +R+  +  +N+Q
Sbjct: 275 SGHGGSITSCHAGSCELTFERLALMVLQNRQ 305


>VIRBB_BRUAB RecName: Full=Type IV secretion system protein virB11;
          Length = 362

 Score = 38.5 bits (88), Expect = 9e-05
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 109 SFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF 168
           + +E G   +    A+    +++V G TGSGK+T + +++  I   +   ++TIED  E 
Sbjct: 157 ALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQ--RLITIEDVPEL 214

Query: 169 F------HKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXX 222
           F      H H       +E  +   +    LRS LR  P  IL+ E+R            
Sbjct: 215 FLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAA 274

Query: 223 XXGHLVMGTLHTNSAPETIDRIVDVFPENQQ 253
                 + + H  S   T +R+  +  +N+Q
Sbjct: 275 SGHGGSITSCHAGSCELTFERLALMVLQNRQ 305


>VIRBB_BRUA2 RecName: Full=Type IV secretion system protein virB11;
          Length = 362

 Score = 38.5 bits (88), Expect = 9e-05
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 109 SFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF 168
           + +E G   +    A+    +++V G TGSGK+T + +++  I   +   ++TIED  E 
Sbjct: 157 ALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQ--RLITIEDVPEL 214

Query: 169 F------HKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXX 222
           F      H H       +E  +   +    LRS LR  P  IL+ E+R            
Sbjct: 215 FLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAA 274

Query: 223 XXGHLVMGTLHTNSAPETIDRIVDVFPENQQ 253
                 + + H  S   T +R+  +  +N+Q
Sbjct: 275 SGHGGSITSCHAGSCELTFERLALMVLQNRQ 305


>PTLH_BORPE RecName: Full=Type IV secretion system protein
           ptlH;AltName: Full=Pertussis toxin liberation protein H;
          Length = 339

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 7/94 (7%)

Query: 122 IAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF----FHKHKRAIV 177
           +A+     +LV G TGSGK+T + ++   I  R+   IVTIED  E        H   + 
Sbjct: 158 LAVQAGKAILVAGQTGSGKTTLMNALSGEIPPRE--RIVTIEDVRELRLDPATNHVHLLY 215

Query: 178 NQREIG-SDTKSFHKALRSVLRQAPDVILVGEMR 210
                G +   S  + LR+ LR AP  IL+ E+R
Sbjct: 216 GTPTEGRTAAVSATELLRAALRMAPTRILLAELR 249


>PTLH_BORPA RecName: Full=Type IV secretion system protein ptlH
           homolog;
          Length = 339

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 7/94 (7%)

Query: 122 IAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF----FHKHKRAIV 177
           +A+     +LV G TGSGK+T + ++   I  R+   IVTIED  E        H   + 
Sbjct: 158 LAVQAGKAILVAGQTGSGKTTLMNALSGEIPPRE--RIVTIEDVRELRLDPATNHVHLLY 215

Query: 178 NQREIG-SDTKSFHKALRSVLRQAPDVILVGEMR 210
                G +   S  + LR+ LR AP  IL+ E+R
Sbjct: 216 GTPTEGRTAAVSATELLRAALRMAPTRILLAELR 249


>PTLH_BORBR RecName: Full=Type IV secretion system protein ptlH
           homolog;
          Length = 339

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 7/94 (7%)

Query: 122 IAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEF----FHKHKRAIV 177
           +A+     +LV G TGSGK+T + ++   I  R+   IVTIED  E        H   + 
Sbjct: 158 LAVQAGKAILVAGQTGSGKTTLMNALSGEIPPRE--RIVTIEDVRELRLDPATNHVHLLY 215

Query: 178 NQREIG-SDTKSFHKALRSVLRQAPDVILVGEMR 210
                G +   S  + LR+ LR AP  IL+ E+R
Sbjct: 216 GTPTEGRTAAVSATELLRAALRMAPTRILLAELR 249


>Y6523_BACAN RecName: Full=Uncharacterized protein
           pXO2-25/BXB0023/GBAA_pXO2_0023;
          Length = 441

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 45/180 (25%), Positives = 84/180 (46%), Gaps = 23/180 (12%)

Query: 83  GRYRVNVFLQRGSVGGV---LRVV-PSAV---KSFEELGLPKNIAE---IAMSPRGLVLV 132
           G  R+N    + + G     LR+V P+ V   K+FE    P+ I +   + M  R  +L+
Sbjct: 157 GSIRINAVHSQNTNGNSTMSLRIVRPNLVLNEKNFETFA-PQFIYDFFKVVMESRNNILI 215

Query: 133 TGPTGSGKSTTLASMIDYIN-ERKACHIVTIEDPIEFFHKHKRAIVNQREIGS----DTK 187
           +G TG+GK+  L  +  ++  + KA   + IED  E    H +++   +++ S    +  
Sbjct: 216 SGETGTGKTEVLKLLFSFVRFDHKA---IMIEDVPE---THVKSLFPDKDVFSWLTGNGV 269

Query: 188 SFHKALRSVLRQAPDVILVGEMRDYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDV 247
           +    + + LR  P  I++ E+R              GH V+ +LH+  A  +  R+V++
Sbjct: 270 TVTDEIVAALRNNPRWIMISELRG-KETYEMIQAVLSGHHVVTSLHSVDAETSPKRLVNM 328


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.322    0.145    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,647,139,040
Number of extensions: 336280990
Number of successful extensions: 846217
Number of sequences better than 1.0e-03: 16746
Number of HSP's gapped: 814578
Number of HSP's successfully gapped: 18885
Length of query: 122
Length of database: 100,000
Length adjustment: 0
Effective length of query: 122
Effective length of database: 100,000
Effective search space: 12200000
Effective search space used: 12200000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)