# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30711.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAS80551.1  [L=136]
Description: tthe0 AAS80551.1 GIB00176CH01 "probable small heat shock protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      4e-12   48.5   0.0    5.2e-12   48.1   0.0    1.1  1  PF00011  Hsp20/alpha crystallin family
  ------ inclusion threshold ------
        6.2    8.9   0.2         13    7.8   0.1    1.5  1  PF11154  Protein of unknown function (DUF2934)
          8    9.5   1.1         15    8.6   0.8    1.4  1  PF09278  MerR, DNA binding
         21    7.5   0.0         57    6.1   0.0    1.7  1  PF01926  GTPase of unknown function
         33    7.2   0.1         62    6.3   0.1    1.5  1  PF08402  TOBE domain
         76    6.0   0.0    1.8e+02    4.9   0.0    1.6  1  PF08946  Osmosensory transporter coiled coil
    1.2e+02    5.2   0.2    1.5e+02    4.8   0.1    1.2  1  PF02050  Flagellar FliJ protein
    1.4e+02    5.0   0.3    3.2e+02    3.8   0.2    1.6  1  PF06698  Protein of unknown function (DUF1192)
    1.5e+02    4.9   0.0    2.4e+02    4.2   0.0    1.3  1  PF02058  Guanylin precursor
    1.6e+02    5.0   0.0    2.7e+02    4.3   0.0    1.4  1  PF10133  Predicted RNA-binding protein
    2.1e+02    2.5   0.0    2.6e+02    2.2   0.0    1.1  1  PF05592  Bacterial alpha-L-rhamnosidase
    2.5e+02    4.4   1.2    4.9e+02    3.4   0.8    1.5  1  PF04380  Protein of unknown function (DUF526)
    2.6e+02    4.5   0.1    4.4e+02    3.8   0.1    1.4  1  PF01796  DUF35 OB-fold domain
    2.7e+02    4.4   1.0    5.1e+02    3.5   0.7    1.5  1  PF10197  N-terminal domain of CBF1 interacting co-repressor 
    3.1e+02    3.9   2.8    1.9e+02    4.5   0.2    1.8  1  PF12329  TATA element modulatory factor 1 DNA binding
    3.5e+02    3.9   0.1    4.8e+02    3.4   0.1    1.3  1  PF05164  Cell division protein ZapA
    5.6e+02    1.8   0.0    8.4e+02    1.3   0.0    1.2  1  PF04514  Bluetongue virus non-structural protein NS2
    1.1e+03    2.1   3.4    4.5e+02    3.3   0.5    1.7  1  PF04394  Protein of unknown function, DUF536


Domain and alignment annotation for each model:
>> PF00011  Hsp20/alpha crystallin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   48.1   0.0   9.4e-16   5.2e-12       2      90 ..      42     128 ..      41     134 .. 0.94

  Alignments for each domain:
  == domain 1    score: 48.1 bits;  conditional E-value: 9.4e-16
     PF00011   2 ikeekdkfevkldvpglkkeelkvkvednkvlvkgeheeeeeddkglrserssrkFsrkftLPenvdkdkvkaslkdGvLtvtvpkkkp 90 
                   e+++++++ +d+pg+++e+l+   e+++v+  g ++     +++l  er ++ F+r++ LP  +++ + +a+l++GvL+v   k+++
  AAS80551.1  42 LLETEEHYVLLVDLPGVRPEDLELLEEGQRVTLAGVRH--PLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPA 128
                 6799********************************99..7888999999*********************************999875 PP

>> PF11154  Protein of unknown function (DUF2934)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.1    0.0024        13       3      15 ..      16      28 ..      15      28 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0024
     PF11154  3 ereerIRerAYel 15
                e++erI+e+AY l
  AAS80551.1 16 ELQERIAELAYLL 28
                689********76 PP

>> PF09278  MerR, DNA binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.8    0.0028        15      41      57 ..      10      26 ..       3      29 .. 0.83

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0028
                HHHHHHHHHHHHHHHHH CS
     PF09278 41 laeklaeleeqiaeLqa 57
                + +kl+el+e+iaeL+ 
  AAS80551.1 10 TLRKLKELQERIAELAY 26
                679************85 PP

>> PF01926  GTPase of unknown function
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0      0.01        57      36      65 ..      46      75 ..      12      81 .. 0.77

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.01
                TTEEEEEEE-----SSCCGHHHHHHHHHHH CS
     PF01926 36 dgkeitliDtpGiiegadkkegelgkkfle 65
                +++ + l+D+pG+++++ + ++e+ + +l+
  AAS80551.1 46 EEHYVLLVDLPGVRPEDLELLEEGQRVTLA 75
                677899********9988887776666665 PP

>> PF08402  TOBE domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.1     0.011        62       2      20 ..      57      76 ..      56      84 .. 0.77

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.011
     PF08402  2 aiRPEklrlaaggan.glsG 20
                ++RPE+l+l ++g+  +l+G
  AAS80551.1 57 GVRPEDLELLEEGQRvTLAG 76
                69*******86665556666 PP

>> PF08946  Osmosensory transporter coiled coil
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.032   1.8e+02      12      31 ..       3      24 ..       1      26 [. 0.87

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.032
     PF08946 12 ehhdnIE..qkIedideqIaeL 31
                e hd  E  +k  ++ e+IaeL
  AAS80551.1  3 ERHDRLEtlRKLKELQERIAEL 24
                7899999666***********9 PP

>> PF02050  Flagellar FliJ protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.1     0.027   1.5e+02       2      24 ..       4      26 ..       3      46 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.027
     PF02050  2 kskrLetlldlaekkeeeaarel 24
                +++rLetl +l+e +e+ a+ ++
  AAS80551.1  4 RHDRLETLRKLKELQERIAELAY 26
                799**********9999888765 PP

>> PF06698  Protein of unknown function (DUF1192)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.2     0.057   3.2e+02      24      33 ..      15      24 ..       4      26 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.057
     PF06698 24 eELeeRIalL 33
                 EL+eRIa L
  AAS80551.1 15 KELQERIAEL 24
                7*******99 PP

>> PF02058  Guanylin precursor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.044   2.4e+02      33      47 ..       7      21 ..       3      34 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.044
                -SHHHHTTTT--S.. CS
     PF02058 33 sLesvkkLkdLeeqd 47
                +Le+++kLk+L+e+ 
  AAS80551.1  7 RLETLRKLKELQERI 21
                69**********965 PP

>> PF10133  Predicted RNA-binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.048   2.7e+02       6      38 ..      25      57 ..      23      61 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.048
     PF10133  6 vylkkgeeeelvmEdVvlieveedgvvltdilg 38
                +yl +gee      +V+l+e ee  v l d+ g
  AAS80551.1 25 AYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPG 57
                688888888888889**************9855 PP

>> PF05592  Bacterial alpha-L-rhamnosidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0     0.047   2.6e+02      50      75 ..      15      40 ..       1      42 [. 0.82

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.047
                ---...---EEEE----...EE---S CS
     PF05592 50 rnlrkakatdeyilkGeeeeewepsf 75
                ++l+++ a+  y l Gee  +w+p+ 
  AAS80551.1 15 KELQERIAELAYLLTGEEPAAWTPRV 40
                67899999****************86 PP

>> PF04380  Protein of unknown function (DUF526)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.8     0.088   4.9e+02      53      68 ..       9      24 ..       7      26 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.088
     PF04380 53 rtRekleaLearlaeL 68
                +t  kl++L++r+aeL
  AAS80551.1  9 ETLRKLKELQERIAEL 24
                57789**********9 PP

>> PF01796  DUF35 OB-fold domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1     0.079   4.4e+02      38      65 ..      47      74 ..      35      77 .. 0.77

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.079
     PF01796 38 egvrvlgrlvgpdpedveeveiGarVra 65
                e   +l  l g+ ped+e +e G+rV +
  AAS80551.1 47 EHYVLLVDLPGVRPEDLELLEEGQRVTL 74
                4667788888999999998999999987 PP

>> PF10197  N-terminal domain of CBF1 interacting co-repressor CIR
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.7     0.092   5.1e+02      22      36 ..       9      23 ..       4      25 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.092
     PF10197 22 eEqkkieerrkeiee 36
                e  +k++e++++i+e
  AAS80551.1  9 ETLRKLKELQERIAE 23
                556899999998876 PP

>> PF12329  TATA element modulatory factor 1 DNA binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.2     0.035   1.9e+02       3      17 ..      10      24 ..       8      28 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.035
     PF12329  3 lekklkeKdeqIaqL 17
                ++ klke +e+Ia+L
  AAS80551.1 10 TLRKLKELQERIAEL 24
                56789********99 PP

>> PF05164  Cell division protein ZapA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1     0.086   4.8e+02      62      85 ..       2      25 ..       1      54 [. 0.86

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.086
     PF05164 62 lkakeeaaeleeleelkerieala 85
                l+ ++++++l++l+el+eri +la
  AAS80551.1  2 LERHDRLETLRKLKELQERIAELA 25
                667788888888999999999997 PP

>> PF04514  Bluetongue virus non-structural protein NS2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.15   8.4e+02      40      67 ..      69      96 ..      63     100 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.15
     PF04514 40 GRtvalkavatPePkgYvleisevgsyR 67
                G+ v l  v+ P P +Y le + +g++R
  AAS80551.1 69 GQRVTLAGVRHPLPGTYLLEERPMGTFR 96
                77899999************99999988 PP

>> PF04394  Protein of unknown function, DUF536
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.5     0.082   4.5e+02      27      42 ..       8      23 ..       7      27 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.082
     PF04394 27 LqankkieeLenqLee 42
                L++  k++eL++++ e
  AAS80551.1  8 LETLRKLKELQERIAE 23
                788999*****99977 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (136 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       235  (0.019728); expected 238.2 (0.02)
Passed bias filter:                      218  (0.0183009); expected 238.2 (0.02)
Passed Vit filter:                        18  (0.00151108); expected 11.9 (0.001)
Passed Fwd filter:                        18  (0.00151108); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              18  [number of targets reported over threshold]
# CPU time: 0.13u 0.04s 00:00:00.17 Elapsed: 00:00:00
# Mc/sec: 2258.54
//