# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30712.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAS80650.1  [L=399]
Description: tthe0 AAS80650.1 GIB00176CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.6e-40  141.0  84.1    1.2e-32  115.7  35.3    1.8  2  PF07690  Major Facilitator Superfamily
     0.0027   19.2  14.3     0.0027   19.2   9.9    2.4  1  PF03209  PUCC protein
  ------ inclusion threshold ------
         30    6.8   0.4      1e+02    5.1   0.3    1.8  1  PF12576  Protein of unknown function (DUF3754)
         37    4.9   1.8         93    3.6   0.1    2.1  1  PF03137  Organic Anion Transporter Polypeptide (OATP) family
         40    6.7   1.7    1.1e+02    5.3   0.5    2.3  1  PF11204  Protein of unknown function (DUF2985)
         58    5.2   0.2         88    4.6   0.2    1.2  1  PF10536  Plant mobile domain
         87    4.2  23.2       0.36   12.0   6.0    2.1  1  PF00083  Sugar (and other) transporter
    1.5e+02    4.7   4.8         22    7.4   0.4    1.7  1  PF12597  Protein of unknown function (DUF3767)
    1.9e+02    3.3   0.4    2.9e+02    2.7   0.2    1.1  1  PF11557  Protein of unknown function (DUF3233)
    2.7e+02    4.5   0.6    8.7e+02    2.8   0.4    1.8  1  PF05079  Protein of unknown function (DUF680)
    3.1e+02    4.1   0.1      6e+02    3.1   0.1    1.4  1  PF12466  Glutamate dehydrogenase N terminal
    4.9e+02    3.1   1.0    1.2e+03    1.8   0.7    1.6  1  PF06671  Repeat of unknown function (DUF1174)
      5e+02    3.2   0.1    8.5e+02    2.4   0.1    1.3  1  PF12404  Peptidase
    9.6e+02    2.3   1.3    2.9e+03    0.8   0.9    1.8  1  PF06103  Bacterial protein of unknown function (DUF948)
    1.3e+03    2.5   0.1    2.4e+03    1.7   0.0    1.3  1  PF03955  Adenovirus hexon-associated protein (IX)


Domain and alignment annotation for each model:
>> PF07690  Major Facilitator Superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  115.7  35.3   1.8e-36   1.2e-32       2     352 ..       9     335 ..       8     336 .. 0.87
   2 !   39.0  17.5   3.9e-13   2.6e-09       4     174 ..     200     376 ..     197     390 .. 0.73

  Alignments for each domain:
  == domain 1    score: 115.7 bits;  conditional E-value: 1.8e-36
     PF07690   2 llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlga 100
                 l +++l + + s l+palp  l +++ + p +++ +++l +lg+a+a l+++ l+ r+G+ r++ +gl+l al++lll++a+sl  +l++lr+lqG+++
  AAS80650.1   9 LSGVLLGTVSESSLAPALP-VLERAFAVGPEAAQGVVSLGLLGAALAYLPLAGLAGRVGAGRLFRTGLFLHALSALLLALAPSLL-ALYLLRLLQGVAT 105
                 66788899999********.9*****************************************************66666757777.************* PP

     PF07690 101 galfpagaaliadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkepaplvpa 199
                 ++++ ++  l+a  fp+  rg alg++++++++G++lgp+lggl a  +g ++vFl+  +++lla     lll    pe +r++++             
  AAS80650.1 106 AMVVGLVPGLAASAFPE-ARGYALGMVASTVAAGTLLGPALGGLAA-GWGLPYVFLLPLPAALLA-----LLLSGNLPELPRQEGTLP----------- 186
                 ****************9.*************************999.778888888888888888.....556555555555544333........... PP

     PF07690 200 wklllkppvlw.llialllfffvfsglltllplylqevlglspglllaglllgllaligaigalllgrlsdrlgrrrrlllallllllaalglallaft 297
                  +ll++p +l  ll++ l+f     g+++ l +      g+spg++ ++lllg l l+++++  ++gr +dr+g  r  ll+  ll++a+l++all++ 
  AAS80650.1 187 -GLLRAPGFLPaLLATGLYFL-HALGTTVALAFH-LGKEGFSPGAIGGLLLLGPLELLFLGA--WAGRRADRMGYNRVALLGAYLLVAAGLAFALLPLL 280
                 .56666675544555555554.333344444443.888999987788998899999999888..*********************************** PP

     PF07690 298 ssavwllvvlvliGfglglvfptllalasdlappeerGtasglfntagslggalg 352
                 +  + ++++l+l+G+g +l++++ +al+ +lap+   G asg+ ++a++lg alg
  AAS80650.1 281 HPLWGSALALLLLGVGRALFQAANNALVLSLAPKGTEGLASGALSVARALGQALG 335
                 99999999*********************************************99 PP

  == domain 2    score: 39.0 bits;  conditional E-value: 3.9e-13
     PF07690   4 aaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalg.lllllfa..sslwalllvlrvlqGlg 99 
                 a+ l++l +  +++al  +l+++ g+sp++ig ll l  l  +++   aGr +dr+G  rv llg+ l++++ l+++l++  ++lw   +++ +l G+g
  AAS80650.1 200 ATGLYFLHALGTTVALAFHLGKE-GFSPGAIGGLLLLGPLELLFLGAWAGRRADRMGYNRVALLGAYLLVAAgLAFALLPllHPLW-GSALALLLLGVG 296
                 55555555556667777788888.9********************************9996666666666662444444356****.9*********** PP

     PF07690 100 agalfpagaaliadwfpkeergralgllsagfslGailgpllggllasslg..WravFlilailsllaav...lvllllp 174
                  +++ +a +al+  ++pk   g+a g ls++ +lG +lg +l+g  + ++   +++  l++a+ +ll++    l+++l++
  AAS80650.1 297 RALFQAANNALVLSLAPKGTEGLASGALSVARALGQALGSALAGGSLGLFYrlFPSHGLAFAATALLLTAlmgLAAFLVR 376
                 ***************************************88888555455456444444444444444331133333333 PP

>> PF03209  PUCC protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.2   9.9     4e-07    0.0027     263     388 ..     246     365 ..     229     379 .. 0.83

  Alignments for each domain:
  == domain 1    score: 19.2 bits;  conditional E-value: 4e-07
     PF03209 263 laglvlsrgldklrlaglgvlvgllaflllilaallenkallvlgvlliGlgaGlfavaaltamldlaaeeqaglalGaWGaaQaiaaglaillggvlr 361
                 +ag+    +++  r+a lg+ + ++a l+  l  ll+  +  +l++ll+G+g  lf +a  +++l+la++++ gla Ga  +a a+  +l+ +l+g+ +
  AAS80650.1 246 WAGRRAD-RMGYNRVALLGAYLLVAAGLAFALLPLLHPLWGSALALLLLGVGRALFQAANNALVLSLAPKGTEGLASGALSVARALGQALGSALAGGSL 343
                 4555544.89999****************9999999999999********************************************************* PP

     PF03209 362 dlvkalaandaalayslvfaleallli 388
                  l   l+ +     ++l fa+ alll 
  AAS80650.1 344 GLFYRLFPS-----HGLAFAATALLLT 365
                 999999874.....4444444444333 PP

>> PF12576  Protein of unknown function (DUF3754)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.3     0.015     1e+02      65     109 ..     334     376 ..     332     378 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.015
     PF12576  65 lglpailgviavlvkivkkillllanillaallialvaliafifr 109
                 lg +  +g + ++++++++ +l++a+   a+ll al++l af++r
  AAS80650.1 334 LGSALAGGSLGLFYRLFPSHGLAFAA--TALLLTALMGLAAFLVR 376
                 66777899999**************8..999***********998 PP

>> PF03137  Organic Anion Transporter Polypeptide (OATP) family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1     0.014        93      18      87 ..      18      87 ..       5      96 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.014
                xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF03137 18 vnaylkssittiEkrFklsssksGlisslydignllliifvsYfgsrvhrprligiGlllmalgslllal 87
                + + l  ++  +E+ F +  +    ++sl  +g +l+ ++++  ++rv   rl   Gl+l al++lllal
  AAS80650.1 18 SESSLAPALPVLERAFAVGPEAAQGVVSLGLLGAALAYLPLAGLAGRVGAGRLFRTGLFLHALSALLLAL 87
                555566667788999988777665666677799*********************************9987 PP

>> PF11204  Protein of unknown function (DUF2985)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.5     0.016   1.1e+02       3      39 ..     265     301 ..     263     309 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.016
     PF11204   3 fvktplgflitiYallvvawGamlvLlllgainaalk 39 
                 ++    g+++++  ll  +wG +l Llllg+  a ++
  AAS80650.1 265 YLLVAAGLAFALLPLLHPLWGSALALLLLGVGRALFQ 301
                 666678888889999999************9887665 PP

>> PF10536  Plant mobile domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.2     0.013        88     116     164 ..       5      53 ..       4      68 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.013
     PF10536 116 LlallgkflfpdksgskvdkevlplardlaqgsrlslGsavLAyLYreL 164
                 Llall+++l+++ s s++ +++  l r++a g++ + G+++L+ L ++L
  AAS80650.1   5 LLALLSGVLLGTVSESSLAPALPVLERAFAVGPEAAQGVVSLGLLGAAL 53 
                 89****************************************9986666 PP

>> PF00083  Sugar (and other) transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   6.0   5.4e-05      0.36      50     196 ..      42     180 ..      31     181 .. 0.87

  Alignments for each domain:
  == domain 1    score: 12.0 bits;  conditional E-value: 5.4e-05
     PF00083  50 livssflvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyqlait 148
                  +vs+ l+ga+  +l +  la r G  + + ++l+l + +a+l a+a+   s+  l + R+++G++  ++ +lvP +++    +++rg   ++  + ++
  AAS80650.1  42 GVVSLGLLGAALAYLPLAGLAGRVGAGRLFRTGLFLHALSALLLALAP---SLLALYLLRLLQGVATAMVVGLVPGLAASA-FPEARGYALGMVASTVA 136
                 589999*********9999*****************************...************************998865.778999999999999** PP

     PF00083 149 vGilvaaiiglglnktsnadgwrillglqlvpallllllllflpeSpr 196
                 +G l++      l+  ++ +g ++ + l+l  all lll   lpe pr
  AAS80650.1 137 AGTLLGPA----LGGLAAGWGLPYVFLLPLPAALLALLLSGNLPELPR 180
                 **998755....445555466677777888888888888888888776 PP

>> PF12597  Protein of unknown function (DUF3767)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.4    0.0033        22      44      77 ..      99     132 ..      98     138 .. 0.91

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0033
     PF12597  44 lltGigagfvvGsvrfligknikkaanWavggfl 77 
                 ll+G+++++vvG v +l  +++++a  +a g+ +
  AAS80650.1  99 LLQGVATAMVVGLVPGLAASAFPEARGYALGMVA 132
                 69***************************99875 PP

>> PF11557  Protein of unknown function (DUF3233)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.2     0.043   2.9e+02     313     326 ..     334     347 ..     329     348 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.043
     PF11557 313 vgSalkGGsivlff 326
                  gSal GGs+ lf+
  AAS80650.1 334 LGSALAGGSLGLFY 347
                 69***********9 PP

>> PF05079  Protein of unknown function (DUF680)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.4      0.13   8.7e+02       2      20 ..     257     275 ..     256     276 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.13
     PF05079   2 kkiaLtaAAiLvasgsAFA 20 
                 +++aL  A +Lva+g AFA
  AAS80650.1 257 NRVALLGAYLLVAAGLAFA 275
                 6899**************9 PP

>> PF12466  Glutamate dehydrogenase N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.09     6e+02       6      33 ..      16      43 ..      15      54 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.09
     PF12466  6 aasksvktsakpaAeravvvtaeerqev 33
                ++s+s+  +a p+ era +v  e+ q+v
  AAS80650.1 16 TVSESSLAPALPVLERAFAVGPEAAQGV 43
                689*****************99999976 PP

>> PF06671  Repeat of unknown function (DUF1174)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.7      0.18   1.2e+03      12      17 ..     379     384 ..     377     386 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.18
     PF06671  12 EaSGEE 17 
                 E+SGEE
  AAS80650.1 379 EGSGEE 384
                 9****9 PP

>> PF12404  Peptidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.13   8.5e+02      43      62 ..     247     266 ..     245     276 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.13
     PF12404  43 AaRkldsqgikkveLaGegW 62 
                 A+R+ d +g ++v+L G   
  AAS80650.1 247 AGRRADRMGYNRVALLGAYL 266
                 9***************9865 PP

>> PF06103  Bacterial protein of unknown function (DUF948)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.9      0.44   2.9e+03       1      27 [.      80     106 ..      80     110 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 0.44
     PF06103   1 iavliiAiAflvLvifliktlkklkkt 27 
                 +++l++A+A  +L+++l+++l+ ++++
  AAS80650.1  80 LSALLLALAPSLLALYLLRLLQGVATA 106
                 5899****************9988766 PP

>> PF03955  Adenovirus hexon-associated protein (IX)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.36   2.4e+03      13      27 ..     243     257 ..     242     259 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.36
     PF03955  13 LpsWAGvrqnvvGsn 27 
                 L +WAG r + +G n
  AAS80650.1 243 LGAWAGRRADRMGYN 257
                 568*********965 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (399 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       380  (0.0319006); expected 238.2 (0.02)
Passed bias filter:                      142  (0.0119208); expected 238.2 (0.02)
Passed Vit filter:                        19  (0.00159503); expected 11.9 (0.001)
Passed Fwd filter:                        19  (0.00159503); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              15  [number of targets reported over threshold]
# CPU time: 0.30u 0.04s 00:00:00.34 Elapsed: 00:00:01
# Mc/sec: 2871.34
//