# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30715.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAS81022.1  [L=434]
Description: tthe0 AAS81022.1 GIB00176CH01 "signal recognition particle protein ffh"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.3e-68  231.3   0.0    7.1e-68  230.6   0.0    1.3  1  PF00448  SRP54-type protein, GTPase domain
    6.5e-32  112.5   0.1    1.9e-31  111.0   0.1    1.8  1  PF02978  Signal peptide binding domain
    2.2e-15   59.1   0.9    9.5e-15   57.1   0.6    2.1  1  PF02881  SRP54-type protein, helical bundle domain
    3.2e-07   32.6   0.1      1e-06   31.0   0.1    1.8  1  PF01656  CobQ/CobB/MinD/ParA nucleotide binding domain
    0.00011   24.4   0.0    0.00021   23.4   0.0    1.5  1  PF02492  CobW/HypB/UreG, nucleotide-binding domain
     0.0013   20.6   0.3      0.025   16.4   0.0    2.5  2  PF06414  Zeta toxin
  ------ inclusion threshold ------
       0.01   18.3   0.0      0.025   17.0   0.0    1.6  1  PF03205  Molybdopterin guanine dinucleotide synthesis protei
       0.31   13.0   0.8       0.77   11.8   0.0    2.1  1  PF02223  Thymidylate kinase
       0.45   12.8   0.2        2.4   10.5   0.0    2.1  1  PF01583  Adenylylsulphate kinase
       0.47   12.2   0.0        1.6   10.4   0.0    2.0  1  PF06745  KaiC
       0.75   11.3   0.3        4.1    8.9   0.0    2.1  1  PF00931  NB-ARC domain
        2.1   10.8   0.0        5.9    9.3   0.0    1.8  1  PF04851  Type III restriction enzyme, res subunit
        2.2   10.7   0.3         13    8.1   0.0    2.3  1  PF07728  AAA domain (dynein-related subfamily)
        2.2   11.1   0.0          8    9.3   0.0    2.2  1  PF00004  ATPase family associated with various cellular acti
        2.9   10.2   2.1         16    7.7   1.5    2.3  1  PF05729  NACHT domain
        2.9   10.0   0.0        8.7    8.5   0.0    1.8  1  PF03029  Conserved hypothetical ATP binding protein
        4.7    8.8   0.0         15    7.2   0.0    1.8  1  PF02374  Anion-transporting ATPase
          5    8.5   0.3         21    6.4   0.0    2.1  1  PF03308  ArgK protein
        5.3    9.4   0.2         15    7.9   0.0    1.8  1  PF00205  Thiamine pyrophosphate enzyme, central domain
        5.4   10.2   0.0         12    9.0   0.0    1.5  1  PF04774  Hyaluronan / mRNA binding family
          8    8.3   0.0         16    7.3   0.0    1.6  1  PF02562  PhoH-like protein
        8.2    8.5   0.0         14    7.7   0.0    1.3  1  PF05272  Virulence-associated protein E
         10    8.5   0.1         43    6.5   0.0    2.0  1  PF00350  Dynamin family
         12    7.6   0.0         25    6.5   0.0    1.5  1  PF01591  6-phosphofructo-2-kinase
         13    7.5   0.0         26    6.6   0.0    1.5  1  PF08433  Chromatin associated protein KTI12
         20    6.9   0.4         42    5.8   0.0    1.7  1  PF11067  Protein of unknown function (DUF2868)
         21    6.9   0.0    1.2e+02    4.4   0.0    2.0  1  PF09439  Signal recognition particle receptor beta subunit
         28    6.9   0.3         91    5.3   0.2    2.0  1  PF11253  Protein of unknown function (DUF3052)
         37    6.7   0.5    1.5e+02    4.7   0.1    2.1  1  PF07652  Flavivirus DEAD domain
         38    6.7   0.0    1.1e+02    5.2   0.0    1.7  1  PF07870  Protein of unknown function (DUF1657)
         40    6.0   0.1         69    5.2   0.0    1.3  1  PF05732  Firmicute plasmid replication protein (RepL)
         43    5.6   0.5      1e+02    4.3   0.1    1.8  1  PF02606  Tetraacyldisaccharide-1-P 4'-kinase
         46    5.2   0.0         85    4.3   0.0    1.4  1  PF10412  Type IV secretion-system coupling protein DNA-bindi
         51    5.4   1.5         44    5.6   0.1    1.5  1  PF06405  Red chlorophyll catabolite reductase (RCC reductase
         52    6.4   2.1    1.2e+02    5.2   0.1    2.7  1  PF00633  Helix-hairpin-helix motif
         63    5.6   0.0    1.2e+02    4.7   0.0    1.5  1  PF05707  Zonular occludens toxin (Zot)
         71    5.7   0.1    1.8e+02    4.4   0.0    1.6  1  PF02367  Uncharacterised P-loop hydrolase UPF0079
         78    5.6   0.0    1.4e+02    4.8   0.0    1.3  1  PF10463  Peptidase U49
         79    5.7   0.1    1.9e+02    4.5   0.0    1.6  1  PF02381  MraZ protein
         89    4.9   0.0      2e+02    3.8   0.0    1.5  1  PF00025  ADP-ribosylation factor family
         97    6.1   1.0    2.5e+02    4.8   0.1    2.2  1  PF06252  Protein of unknown function (DUF1018)
    1.1e+02    5.7   0.1    2.1e+02    4.7   0.0    1.4  1  PF00910  RNA helicase
    1.1e+02    3.8   0.0    1.7e+02    3.2   0.0    1.1  1  PF01293  Phosphoenolpyruvate carboxykinase
    1.1e+02    3.1   0.0    1.8e+02    2.4   0.0    1.2  1  PF00972  Flavivirus RNA-directed RNA polymerase
    1.2e+02    5.5   0.0    4.1e+02    3.8   0.0    1.8  1  PF12005  Protein of unknown function (DUF3499)
    1.4e+02    5.2   0.2    5.6e+02    3.3   0.2    2.0  1  PF09784  Mitochondrial ribosomal protein L31
    1.5e+02    5.1   0.0    4.5e+02    3.5   0.0    1.7  1  PF06947  Protein of unknown function (DUF1290)
    1.7e+02    4.6   0.0    4.9e+02    3.1   0.0    1.7  1  PF09400  Protein of unknown function (DUF2002)
    1.9e+02    5.0   0.6    5.3e+02    3.7   0.4    1.8  1  PF07460  NUMOD3 motif
      2e+02    5.1   0.1      5e+02    3.8   0.1    1.8  1  PF08477  Miro-like protein
      2e+02    4.4   4.9    5.1e+02    3.1   0.7    2.8  2  PF05524  PEP-utilising enzyme, N-terminal
    2.9e+02    3.9   0.7    9.2e+02    2.3   0.1    2.0  1  PF00406  Adenylate kinase
    4.1e+02    3.5   0.1    9.4e+02    2.3   0.1    1.6  1  PF08640  U3 small nucleolar RNA-associated protein 6
    4.3e+02    3.4   2.7    6.2e+02    2.8   0.3    2.3  1  PF00106  short chain dehydrogenase
    5.4e+02    0.9   0.0    7.9e+02    0.4   0.0    1.1  1  PF07598  Protein of unknown function (DUF1561)
    5.7e+02    2.8   1.2    2.1e+03    0.9   0.3    2.2  1  PF01935  Domain of unknown function DUF87
    6.3e+02    2.8   0.0    1.4e+03    1.7   0.0    1.5  1  PF02894  Oxidoreductase family, C-terminal alpha/beta domain
    7.1e+02    3.1   0.0    1.4e+03    2.1   0.0    1.4  1  PF07472  Fucose-binding lectin II (PA-IIL)
    7.2e+02    2.6   0.0    1.3e+03    1.8   0.0    1.3  1  PF09965  Uncharacterized protein conserved in bacteria (DUF2
    1.2e+03    1.9   7.4    8.9e+02    2.3   0.4    3.5  3  PF01202  Shikimate kinase
    1.4e+03    1.2   0.0      3e+03    0.1   0.0    1.4  1  PF01555  DNA methylase
    1.5e+03    0.9   0.1    3.3e+03   -0.2   0.1    1.4  1  PF00481  Protein phosphatase 2C


Domain and alignment annotation for each model:
>> PF00448  SRP54-type protein, GTPase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.6   0.0   4.4e-71   7.1e-68       2     196 .]      99     293 ..      98     293 .. 0.99

  Alignments for each domain:
  == domain 1    score: 230.6 bits;  conditional E-value: 4.4e-71
                 EEEEEE-------TTTHCCHHHHHHCTS--EEEEEESTSSCCCHHHHHHHHHHTT--EEE-SS--CHHHHHHHHHHHHHHTTSSEEEEEE---GSSHHH CS
     PF00448   2 nvillvGlqGaGKTTtlaKLAallkkegkkvllvaaDtfRaaAveQLktlaeklgvpvikekeekdpaavakeavekakeekidvvlvDTaGrlqndke 100
                 nv+ lvGlqG+GKTTt+aKLA ++k +g+++llvaaDt R+aA eQL++l+ek+gvpv++ + +++p ++ ++  e+a+ e  d+vlvDTaGrlq+d++
  AAS81022.1  99 NVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRVLGEKVGVPVLEVQDGESPESIRRRVEERARLEVRDLVLVDTAGRLQIDER 197
                 7899**********************************************************9************************************ PP

                 HHHHHHHHHCCSTTSEEEEEEETTB-HCCHHHHHHHHCC-S-SEEEEESTTTSS----HHHHHHHCT--EEEEE----CCCCEE--HHHHHHHHHT CS
     PF00448 101 lmeelkkikkvlkpdevllvldatigqealkqakaFkeaveltgviltklDgdakgGaalsiaaelklPikfigvGekiedleefdperlvsrllg 196
                 lmeel ++k +l+pdevllvlda++gqeal+ a+aF+e+v++tg++ltklDgda+gGaals+++++++Pi+f gv+e+ e le+f p+rl+ r+lg
  AAS81022.1 198 LMEELVRLKAALRPDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLEPFYPDRLAGRILG 293
                 *********************************************************************************************985 PP

>> PF02978  Signal peptide binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  111.0   0.1   1.1e-34   1.9e-31       2     104 .]     320     417 ..     319     417 .. 0.96

  Alignments for each domain:
  == domain 1    score: 111.0 bits;  conditional E-value: 1.1e-34
                 -HCHHHHHCCTTSS-----S-SS------...-------SS---HHH.HHHHHHHHCCS-HHHHCSGCC--HHHHHHHH------HHHHHHHHHHHHHH CS
     PF02978   2 ftledfleqlkqikkmGslkkllkmlPglgslakdlpeekeeqaaekelkkleaiidSMTkkErqnpelledsRvrRiakGsGtsveevneLlkqfkqm 100
                 +tledfl+q++++k++Gs+++llk lPg+g++   lp+    q++e+++k+leai+ SMT++Er++p++l++sR+rRiakGsGt+v+evn+L+k f+++
  AAS81022.1 320 LTLEDFLKQMQNLKRLGSFSELLKLLPGVGRA---LPQG--FQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEET 413
                 79****************************98...7775..689******************************************************9 PP

                 HCCT CS
     PF02978 101 kkmm 104
                 k++m
  AAS81022.1 414 KALM 417
                 9887 PP

>> PF02881  SRP54-type protein, helical bundle domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.1   0.6   5.9e-18   9.5e-15       2      75 .]       6      82 ..       5      82 .. 0.95

  Alignments for each domain:
  == domain 1    score: 57.1 bits;  conditional E-value: 5.9e-18
                -------------..---------HHHHHHHHHHH----HHHHHHHHHHHHHCCH....C-----TTTT---HHHHH CS
     PF02881  2 kkglsktrnkltgklfltekkidelleeleeaLleaDVgvevvkkliervreklvg...kkgvspkeeikkilkdeL 75
                  +l+ ++++l+g+  +te++++ +l+e+++aL+eaDV++ev++ ++e+vre+++g    + ++p+e +  +++++L
  AAS81022.1  6 AARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLEVARAFVEEVRERALGrkvLESLTPAEVVLATVYEAL 82
                5799************************************************999999999*******999999987 PP

>> PF01656  CobQ/CobB/MinD/ParA nucleotide binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.0   0.1   6.2e-10     1e-06       9     184 ..     108     271 ..     107     281 .. 0.69

  Alignments for each domain:
  == domain 1    score: 31.0 bits;  conditional E-value: 6.2e-10
                 T---HHHHHHHHHHHHH----EEEEES--SSSSHHHH--EB-----HCHHHHH.-S-HCCCHHHHHH.......HHHHHHHHHHCH.-SEEEEE----- CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxx RF
     PF01656   9 GvGKTtlaanLaralakrglrVlliDlDpqannssllgkveilkkglekasal.lenfeagllaegeeglvesllkkalealikea.yDvviiDgapgl 105
                 G+GKTt+aa La + + +g+r ll+ +D+q ++++  +     +  +ek+    le  + ++         es  +++ e+ ++++  D+v++D+a+ l
  AAS81022.1 108 GSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQL-----RVLGEKVGVPvLEVQDGES--------PESIRRRVEER-ARLEvRDLVLVDTAGRL 192
                 99*******************************77554.....3334333322432222222........23344555555.555569*********** PP

                 -HC........HHHHHCHSCEEEEEE-SSH..HHHHH--HHHHHHHH--..-EE---EEEEES----HHHHHHHHHHCCHSSS...B.S CS
                 xxx........xxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF01656 106 gel........vanalqaadllvvviepek..fsvegakrilellerlgkklkilgvvlnkvdrgnerhleeevealerklgvpvvlpg 184
                              +a+  +d +++v++++    +++ a++++e +        + g vl+k+d g++r     ++  +r +g+p ++ g
  AAS81022.1 193 QIDerlmeelvRLKAALRPDEVLLVLDAMTgqEALSVAQAFDERVG-------VTGLVLTKLD-GDARGGA--ALSARRVTGKPIYFAG 271
                 *********9944555556666666666554488********9999.......99*******5.5455444..2333344555555555 PP

>> PF02492  CobW/HypB/UreG, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.4   0.0   1.3e-07   0.00021       3     147 ..     101     248 ..      99     259 .. 0.81

  Alignments for each domain:
  == domain 1    score: 23.4 bits;  conditional E-value: 1.3e-07
                 EEEE-------HHHHHHHHH.CT...S-EEEEES-TT..THCCCCCH..HT-S-EEEEE----ECC-TTS-CCCHHHHHHHCHGG-SEEEEE---.-SG CS
     PF02492   3 tvltGflGsGKTtLleklle.knraglkiavivndfge.tsiDaell..retgveivelnnGciCctlredllmelealeelkerldvlliEttG.lae 96 
                   l+G  GsGKTt   kl    + +g++   +  d +  +  ++ ++  ++ gv+++e+++G+ +  +r    + +e+ ++l+   d++l+ t G l  
  AAS81022.1 101 WFLVGLQGSGKTTTAAKLALyYKGKGRRPLLVAADTQRpAAREQLRVlgEKVGVPVLEVQDGESPESIR----RRVEERARLE-VRDLVLVDTAGrLQI 194
                 5799***********99998877899*********99876777777754444999**********9955....6666667777.679********8888 PP

                 GGGHHS....HHHHEEE-EEEEEEETTTHCHHHHCTCCHHHHGGG-SEEEEE-CC CS
     PF02492  97 paplld....lksdlgldavvavvdvknltegedkpekledqlaaAdliilnKiD 147
                    l++    lk+ l+ d v  v+d+   +e  + ++ + + + ++ l +l+K D
  AAS81022.1 195 DERLMEelvrLKAALRPDEVLLVLDAMTGQEALSVAQAFDERVGVTGL-VLTKLD 248
                 888855566799**************7778888888888888877765.566766 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   16.4   0.0   1.5e-05     0.025      10      54 ..      92     138 ..      83     143 .. 0.81
   2 ?    1.8   0.1      0.44     7e+02     114     147 ..     143     176 ..     133     221 .. 0.76

  Alignments for each domain:
  == domain 1    score: 16.4 bits;  conditional E-value: 1.5e-05
     PF06414  10 vpeqekpkavllgGqpGAGKtslaellleela..agnivridaDelr 54 
                  p+ + + + +l+G +G+GKt++a +l   ++  +++++ + aD+ r
  AAS81022.1  92 HPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKgkGRRPLLVAADTQR 138
                 466699********************999988777778888887765 PP

  == domain 2    score: 1.8 bits;  conditional E-value: 0.44
     PF06414 114 rklkkagykvevvivavpkelSelgilqRyeeel 147
                 ++l+  g kv v +++v+   S ++i+ R ee++
  AAS81022.1 143 EQLRVLGEKVGVPVLEVQDGESPESIRRRVEERA 176
                 55666788999********************993 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   17.0   0.0   1.5e-05     0.025       4      34 ..     102     132 ..      99     139 .. 0.88

  Alignments for each domain:
  == domain 1    score: 17.0 bits;  conditional E-value: 1.5e-05
                 EEE-E-----HHHHHHHHHHHHH----EEEE CS
     PF03205   4 lvvGpkdsGKTTliekllnilkergyrvavv 34 
                   vG ++sGKTT+  kl+ + k +g+r+  v
  AAS81022.1 102 FLVGLQGSGKTTTAAKLALYYKGKGRRPLLV 132
                 579************************9954 PP

>> PF02223  Thymidylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.0   0.00048      0.77       3      30 ..     105     133 ..     103     152 .. 0.81

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00048
                 --TT---HHHHHHHHHHHHHSEE-.EEEE CS
     PF02223   3 GlDGaGKttqaellkeklkeqgik.vvlt 30 
                 Gl G+GKtt a +l+ ++k +g++ +++ 
  AAS81022.1 105 GLQGSGKTTTAAKLALYYKGKGRRpLLVA 133
                 99********************9865554 PP

>> PF01583  Adenylylsulphate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.0    0.0015       2.4       4      42 ..     100     138 ..      97     150 .. 0.82

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.0015
                 EEEEE-ETT---HHHHHHHHHHHHHTS--EEEE---CST CS
     PF01583   4 vvwltGlsgsGKstiavalekkLvekgikvylLdGdnvR 42 
                 v +l Gl gsGK+t a +l+ + + kg++  l+  d+ R
  AAS81022.1 100 VWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR 138
                 45689**************99999999888777777766 PP

>> PF06745  KaiC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.4   0.0     0.001       1.6      17      71 ..      96     149 ..      89     207 .. 0.91

  Alignments for each domain:
  == domain 1    score: 10.4 bits;  conditional E-value: 0.001
     PF06745  17 pegrvvlitGepGtGKtifalqFlikgaeeygepgvfvtveesaedlrenakslg 71 
                  +++v  ++G  G+GKt+ a++ ++    + g++ ++v+ + ++ + re+ + lg
  AAS81022.1  96 KDRNVWFLVGLQGSGKTTTAAKLALYYKGK-GRRPLLVAADTQRPAAREQLRVLG 149
                 56889999**************99887667.*************99999988887 PP

>> PF00931  NB-ARC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0025       4.1      17      38 ..      96     117 ..      78     125 .. 0.83

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0025
                 SSSEEEEEE-------HHHHHH CS
     PF00931  17 eelkvvglvGmgGvGKttlakq 38 
                 +++ v +lvG  G+GKtt+a++
  AAS81022.1  96 KDRNVWFLVGLQGSGKTTTAAK 117
                 789999*************987 PP

>> PF04851  Type III restriction enzyme, res subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0    0.0037       5.9      23      57 ..      96     133 ..      45     146 .. 0.75

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.0037
                 .TTT---EEE------HHHHHHHHHHH-S...-EEEEE CS
     PF04851  23 dekkrglivmaTGtGKTlvaasliarlar...kflflv 57 
                 ++++   +v   G+GKT +aa+l++++     + l+++
  AAS81022.1  96 KDRNVWFLVGLQGSGKTTTAAKLALYYKGkgrRPLLVA 133
                 566666788889**********8887766777444444 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.0    0.0081        13       3      24 ..     102     126 ..     101     149 .. 0.77

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.0081
     PF07728   3 lLvGppGtgKselaerlaeal...n 24 
                 +LvG +G+gK++ a +la  +   +
  AAS81022.1 102 FLVGLQGSGKTTTAAKLALYYkgkG 126
                 8****************98887443 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0     0.005         8       3      69 ..     103     192 ..     101     292 .. 0.71

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.005
                 EE-------HHHHHHHHHHTT...CE....EEEEETTSSSSS...................T.HCHHHHHHHHHHHHHHTS.SEEEEEETGGGT CS
     PF00004   3 lyGppGtGKTllakavakelg...ve....fleisgsellsk...................yvgesekkirelfkeakeka.psvlfiDEidal 69 
                 l+G  G GKT++a  +a   +   ++       ++ +                          ges++ ir  ++e  + +    +++D + +l
  AAS81022.1 103 LVGLQGSGKTTTAAKLALYYKgkgRRpllvAADTQRP----AareqlrvlgekvgvpvlevQDGESPESIRRRVEERARLEvRDLVLVDTAGRL 192
                 89**************988743332223221222222....11223444444555555555667777777777766333333466666666665 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   1.5      0.01        16       2      25 ..     100     123 ..      99     242 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.01
     PF05729   2 tvilqGeaGsGKTtLlqklasawa 25 
                 + +l+G +GsGKTt ++kla   +
  AAS81022.1 100 VWFLVGLQGSGKTTTAAKLALYYK 123
                 56899**************97655 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0    0.0054       8.7       2      33 ..     104     135 ..     103     144 .. 0.88

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.0054
     PF03029   2 vGpaGsGKttfvgalseilelskrsvavvNLD 33 
                 vG  GsGKtt   +l+ +++ ++r++ +v  D
  AAS81022.1 104 VGLQGSGKTTTAAKLALYYKGKGRRPLLVAAD 135
                 899*********************99999877 PP

>> PF02374  Anion-transporting ATPase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0091        15       4      38 ..     101     135 ..      98     146 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0091
                 EEEE-------HHHHHHHHHHHHC----EEEEE-- CS
     PF02374   4 iffgGKGGVGKttvsaatavklseqgkkvllvstD 38 
                  f+ G  G GKtt +a +a++   +g++ llv+ D
  AAS81022.1 101 WFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAAD 135
                 57778889************************998 PP

>> PF03308  ArgK protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.013        21      34      90 ..     103     161 ..      97     174 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.013
                 -B-------HHHHHH---HHHH----EEEEEE---------..----------TTTT-T CS
     PF03308  34 ltGvPGaGkstlveklikelrrrGkrvavlavDPsspftGG..silGDrlRlerlavde 90 
                 l G  G+Gk t+  kl+   + +G+r  ++a D   p +     +lG+++ +  l+v++
  AAS81022.1 103 LVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREqlRVLGEKVGVPVLEVQD 161
                 67999****************************88776544115688887776666655 PP

>> PF00205  Thiamine pyrophosphate enzyme, central domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.0    0.0095        15      12      48 ..     127     162 ..     123     167 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0095
                 SSEEEEE-CHHCHTTGHHHHHHHHHHHT-EEEECGGG CS
     PF00205  12 krPvilvGggvrrseakeelralaeklgipvvttlmg 48 
                 +rP++++ + ++r  a+e+lr l ek+g+pv++ + g
  AAS81022.1 127 RRPLLVA-ADTQRPAAREQLRVLGEKVGVPVLEVQDG 162
                 5676655.56667******************987766 PP

>> PF04774  Hyaluronan / mRNA binding family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0077        12      70      93 ..     310     334 ..     295     339 .. 0.72

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0077
     PF04774  70 eeeveeedkemtLeey.kalqekrr 93 
                 e+e  +++ke+tLe++ k++q+ +r
  AAS81022.1 310 EAEAPKSAKELTLEDFlKQMQNLKR 334
                 2233466**************9766 PP

>> PF02562  PhoH-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.0    0.0098        16      16      44 ..      95     123 ..      57     157 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.0098
     PF02562  16 lkkndivfaiGpaGtGKTylavalaveal 44 
                 lk++++ f++G  G+GKT  a  la+   
  AAS81022.1  95 LKDRNVWFLVGLQGSGKTTTAAKLALYYK 123
                 678899****************9998655 PP

>> PF05272  Virulence-associated protein E
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0    0.0088        14      46      76 ..      92     122 ..      60     127 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0088
     PF05272  46 ePgckfDevliLqGeqgigKstflkkLggew 76 
                 +P  k   v  L+G qg+gK+t+ +kL+ ++
  AAS81022.1  92 HPQLKDRNVWFLVGLQGSGKTTTAAKLALYY 122
                 68899999******************98665 PP

>> PF00350  Dynamin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.027        43      97     167 ..     177     246 ..     148     247 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.027
                 ETTS-SEEEEE------------.HHHHHHH.STTEEEEEEEETTS-STT-SHHHHHHHH------EE-EEE- CS
     PF00350  97 sllvkgltlvDtPGldsvnkrdq.elveeyi.kkadiilavtdanhdlstsealflarevdpkgkrtivVltk 167
                  l v +l+lvDt G  ++++r   elv+  +  + d +l+v da +    +eal +a++ d++   t +Vltk
  AAS81022.1 177 RLEVRDLVLVDTAGRLQIDERLMeELVRLKAaLRPDEVLLVLDAMT---GQEALSVAQAFDERVGVTGLVLTK 246
                 567899*********99888887888877777999999***99977...678999999999999999999998 PP

>> PF01591  6-phosphofructo-2-kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.016        25      15      39 ..     100     124 ..      90     146 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.016
                 EEEEE--TT---HHHHHHHHHHHHH CS
     PF01591  15 vivlvGLpargKtyiskkltrylkw 39 
                 v  lvGL   gKt++++kl  y k 
  AAS81022.1 100 VWFLVGLQGSGKTTTAAKLALYYKG 124
                 5579***************999875 PP

>> PF08433  Chromatin associated protein KTI12
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.016        26       6      41 ..     103     138 ..     101     187 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.016
     PF08433   6 ltGlPssGKstvakeLakaleeegrsvvvisdeslg 41 
                 l Gl  sGK+t a++La + + +gr+  ++  ++ +
  AAS81022.1 103 LVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR 138
                 679999****************99998888877655 PP

>> PF11067  Protein of unknown function (DUF2868)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.026        42     221     277 ..      94     149 ..      32     151 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.026
     PF11067 221 elddawplpaggaasvaddreqvaqllselaaapdarvviaveawelPdrgllrllq 277
                 +l+d+ ++ + g ++  +  +++a+l+ + + +   ++++a++ +++  r+ lr+l 
  AAS81022.1  94 QLKDRNVWFLVGLQGSGK-TTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRVLG 149
                 677777777777777666.8999******************************9985 PP

>> PF09439  Signal recognition particle receptor beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.076   1.2e+02       3      24 ..      98     119 ..      96     129 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.076
                 --BEEEE--TT---HHHHHHHH CS
     PF09439   3 kpavllvGlsdsGKTslftrLt 24 
                 ++   lvGl+ sGKT+   +L 
  AAS81022.1  98 RNVWFLVGLQGSGKTTTAAKLA 119
                 667789*********9888876 PP

>> PF11253  Protein of unknown function (DUF3052)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.2     0.057        91      57     109 ..     195     247 ..     148     263 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.057
     PF11253  57 dgDLvdaLvdaltslaeggvvwvltPkagregavepadiaeaaetagLvqtss 109
                 d+ L+++Lv   ++l  + v++vl   +g+e    +   +e + ++gLv t+ 
  AAS81022.1 195 DERLMEELVRLKAALRPDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKL 247
                 788**************************99999999999********99975 PP

>> PF07652  Flavivirus DEAD domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.1     0.096   1.5e+02      22      55 ..      51      84 ..      45      87 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.096
                HHHHHHHHHHTT--EEEEESSHHHHHHHHHHT-- CS
     PF07652 22 lpelvkeaierrlrtlvLaPtrvvlaemeealkg 55
                ++e v+e +  r+    L+P+ vvla ++ealk+
  AAS81022.1 51 FVEEVRERALGRKVLESLTPAEVVLATVYEALKE 84
                556666665556666679**************97 PP

>> PF07870  Protein of unknown function (DUF1657)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.067   1.1e+02      31      49 ..       1      19 [.       1      19 [. 0.96

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.067
     PF07870 31 mYeqaaeqleevindLkpr 49
                m++q a  l+e i+ L++r
  AAS81022.1  1 MFQQLAARLQEAIDRLRGR 19
                9**************9987 PP

>> PF05732  Firmicute plasmid replication protein (RepL)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.043        69      78     107 ..     389     418 ..     379     422 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.043
     PF05732  78 nRelaeetgislktvsetlkileeanilkk 107
                 +R++a+  g+ ++ v++ +k++ee+  l k
  AAS81022.1 389 RRRIAKGSGTTVQEVNRLVKAFEETKALMK 418
                 699*********************998877 PP

>> PF02606  Tetraacyldisaccharide-1-P 4'-kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.1     0.064     1e+02      47      71 ..     108     132 ..     104     149 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.064
     PF02606  47 GtGKTPlviaLaellkarglkvgvl 71 
                 G+GKT ++  La ++k +g ++  +
  AAS81022.1 108 GSGKTTTAAKLALYYKGKGRRPLLV 132
                 9*********************987 PP

>> PF10412  Type IV secretion-system coupling protein DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.053        85      18      45 ..     101     128 ..      87     137 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.053
     PF10412  18 ilivGttGtGKtqalrelldqirargdr 45 
                  ++vG +G+GKt++  +l    + +g+r
  AAS81022.1 101 WFLVGLQGSGKTTTAAKLALYYKGKGRR 128
                 5789************998877777766 PP

>> PF06405  Red chlorophyll catabolite reductase (RCC reductase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.1     0.027        44     220     248 ..      32      60 ..      17      66 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.027
                 HHHHHHHHHHHHHTHHHHH---HHHHHHH CS
     PF06405 220 rivrkksiEvdldsklprlFgeevadrvv 248
                 r +r++ iE d++ +++r F eev +r +
  AAS81022.1  32 REIRRALIEADVNLEVARAFVEEVRERAL 60 
                 789*********************99976 PP

>> PF00633  Helix-hairpin-helix motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.073   1.2e+02      11      22 ..     340     351 ..     340     352 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.073
                 HHHHTCTT---H CS
     PF00633  11 eeLlalPGVGpk 22 
                 e L+ lPGVG++
  AAS81022.1 340 ELLKLLPGVGRA 351
                 67999*****96 PP

>> PF05707  Zonular occludens toxin (Zot)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.073   1.2e+02       2      30 ..     100     128 ..      99     198 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.073
     PF05707   2 iylvtGkpGsGKtleaVskdilpalkeGr 30 
                 + +  G  GsGKt  a +  +  + k  r
  AAS81022.1 100 VWFLVGLQGSGKTTTAAKLALYYKGKGRR 128
                 56899***********9996655555444 PP

>> PF02367  Uncharacterised P-loop hydrolase UPF0079
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0      0.11   1.8e+02      11      37 ..      94     120 ..      87     128 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.11
                 HHSS-EEEEEE-------HHHH----- CS
     PF02367  11 llkagdvvlLsGdlGaGKTtlvkglak 37 
                 +lk  +v +L G  G+GKTt +  la 
  AAS81022.1  94 QLKDRNVWFLVGLQGSGKTTTAAKLAL 120
                 68889999************9888775 PP

>> PF10463  Peptidase U49
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.087   1.4e+02     167     185 ..      80      98 ..      47     111 .. 0.77

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.087
     PF10463 167 lelknklggsktHPalqdR 185
                   lk+ lgg+ +HP+l+dR
  AAS81022.1  80 EALKEALGGEPKHPQLKDR 98 
                 3579**************9 PP

>> PF02381  MraZ protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.12   1.9e+02       9      27 ..     185     203 ..     181     209 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.12
                 -B-TTSEEE--CHHHHHTT CS
     PF02381   9 elDskGRiliPaklreeak 27 
                  +D++GR+ i  +l+ee+ 
  AAS81022.1 185 LVDTAGRLQIDERLMEELV 203
                 57**************985 PP

>> PF00025  ADP-ribosylation factor family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.13     2e+02      18      35 ..     102     119 ..      91     125 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.13
                 EEE--TT---HHHHHHHH CS
     PF00025  18 lilGLDnaGKtTilyklk 35 
                  ++GL ++GKtT   kl 
  AAS81022.1 102 FLVGLQGSGKTTTAAKLA 119
                 579*********988885 PP

>> PF06252  Protein of unknown function (DUF1018)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.1      0.16   2.5e+02      17      39 ..     315     337 ..     302     426 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.16
     PF06252  17 tSakdltlaelkkvldelkekGf 39 
                 +Sak+ltl+++ k ++ lk++G 
  AAS81022.1 315 KSAKELTLEDFLKQMQNLKRLGS 337
                 79******************995 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0      0.13   2.1e+02       2      20 ..     102     120 ..     101     131 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.13
     PF00910   2 wlyGpsgeGKStlakeLak 20 
                 +l+G +g GK+t+a +La 
  AAS81022.1 102 FLVGLQGSGKTTTAAKLAL 120
                 789************9875 PP

>> PF01293  Phosphoenolpyruvate carboxykinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0       0.1   1.7e+02     209     229 ..      96     116 ..      91     128 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.1
                 ----EEEEE-------HHHH- CS
     PF01293 209 edgdvalfFGlsGTGKTTLsa 229
                 +d +v  + Gl G+GKTT +a
  AAS81022.1  96 KDRNVWFLVGLQGSGKTTTAA 116
                 577889999*********776 PP

>> PF00972  Flavivirus RNA-directed RNA polymerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.11   1.8e+02     490     519 ..     389     418 ..     377     430 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.11
                 ------------------------------ CS
     PF00972 490 rariskGagwsiketaclakayaqmwslly 519
                 r ri kG+g +++e   l ka+ +  +l+ 
  AAS81022.1 389 RRRIAKGSGTTVQEVNRLVKAFEETKALMK 418
                 889*******************99999885 PP

>> PF12005  Protein of unknown function (DUF3499)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.25   4.1e+02      75     117 ..     295     337 ..     282     343 .. 0.74

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.25
     PF12005  75 dDlvaladavreaareekekaaeeeesgeaeepsskeagRrgh 117
                  D++ la+ vr+a+ e+++ ++ +e + e   +++++ +R g 
  AAS81022.1 295 GDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGS 337
                 6999**********98776666665555555556777777665 PP

>> PF09784  Mitochondrial ribosomal protein L31
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.2      0.35   5.6e+02      17      66 ..     167     216 ..     166     236 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.35
     PF09784  17 SatqKarqRkRlravDdviktlkealeekgkslkklekllaklpkeeems 66 
                 S +++  +R Rl   D v+   +  l+++ + +++l++l+a l+++e + 
  AAS81022.1 167 SIRRRVEERARLEVRDLVLVDTAGRLQIDERLMEELVRLKAALRPDEVLL 216
                 5678999**********************99*******999987776555 PP

>> PF06947  Protein of unknown function (DUF1290)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.28   4.5e+02      32      62 ..     214     244 ..     206     247 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.28
     PF06947  32 vlaalDsvlGalraalekkfdekvfisgfls 62 
                 vl +lD++ G    ++ + fde+v ++g++ 
  AAS81022.1 214 VLLVLDAMTGQEALSVAQAFDERVGVTGLVL 244
                 7889***********************9975 PP

>> PF09400  Protein of unknown function (DUF2002)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0       0.3   4.9e+02       3      32 ..     209     238 ..     207     252 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.3
     PF09400   3 lrpdevarvlekaGfevdvvtnkayGyrkG 32 
                 lrpdev  vl+ +  +  + + +a+  r G
  AAS81022.1 209 LRPDEVLLVLDAMTGQEALSVAQAFDERVG 238
                 9*********99887777888888776655 PP

>> PF07460  NUMOD3 motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.4      0.33   5.3e+02       7      14 .]     411     418 ..     411     418 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.33
                 HHHHHHHH CS
     PF07460   7 EETKkKmS 14 
                 EETK++m+
  AAS81022.1 411 EETKALMK 418
                 9******6 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1      0.31     5e+02       3      20 ..     102     119 ..     101     235 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.31
                 EEE--TT---HHHHHHHH CS
     PF08477   3 vvvGdkgvGKssllsqlv 20 
                 ++vG +g+GK++  ++l+
  AAS81022.1 102 FLVGLQGSGKTTTAAKLA 119
                 6899********998887 PP

>> PF05524  PEP-utilising enzyme, N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.7      0.32   5.1e+02      37      89 ..       6      58 ..       2      87 .. 0.81
   2 ?    1.6   0.0      0.94   1.5e+03      31      57 ..     397     423 ..     379     428 .. 0.76

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.32
     PF05524 37 ierleaAlekareeleelaeqlseelgaeeaaileahlllleDpelleeveer 89
                 +rl++A++++r + + ++e+l+ +l +  +a++ea   l   ++++eev+er
  AAS81022.1  6 AARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLEVARAFVEEVRER 58
                589************999*9******77777*****99999999999999876 PP

  == domain 2    score: 1.6 bits;  conditional E-value: 0.94
     PF05524  31 sdveaEierleaAlekareeleelaeq 57 
                   + +E++rl +A+e++++ +++l+++
  AAS81022.1 397 GTTVQEVNRLVKAFEETKALMKSLERR 423
                 45668999******9999999888876 PP

>> PF00406  Adenylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.57   9.2e+02       1      20 [.     103     122 ..     103     127 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.57
                 EE--TT-----HHHHHHHHH CS
                 xxxxxxxxxxxxxxxxxxxx RF
     PF00406   1 llGaPgaGKGtqaeklvkky 20 
                 l+G  g+GK t a+kl+  y
  AAS81022.1 103 LVGLQGSGKTTTAAKLALYY 122
                 6899***********98666 PP

>> PF08640  U3 small nucleolar RNA-associated protein 6
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.58   9.4e+02       1      19 [.     322     340 ..     322     341 .. 0.94

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.58
     PF08640   1 LEqsvpeLedLeekglftk 19 
                 LE++++++++L++ g f++
  AAS81022.1 322 LEDFLKQMQNLKRLGSFSE 340
                 8****************85 PP

>> PF00106  short chain dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.3      0.38   6.2e+02      25     110 ..     126     211 ..     105     233 .. 0.59

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.38
                 -EEEEEESSS.SHHHHHHHHHHHHHTS.CEEEEEETTTTSHHHHHHHHHHHHHHS---SEEEE----TT.CSSCGHHHHHHHHHHHHH CS
     PF00106  25 arhlvlvsrredapgaaeliaelealg.aevtvvacDvadrdalaallaeirkelgpldgvvhaagvld.dglleeltperlervlap 110
                 +r+ +lv+ +++ p+a+e ++ l ++  + v  v  D ++++++++ ++e +  + +  ++v +ag l+ d+ l e +  rl++ l+p
  AAS81022.1 126 GRRPLLVAADTQRPAAREQLRVLGEKVgVPVLEV-QDGESPESIRRRVEERARLEVRDLVLVDTAGRLQiDERLME-ELVRLKAALRP 211
                 4444444444466666666665653321333333.47777888888887777444444567888888886444433.24556665555 PP

>> PF07598  Protein of unknown function (DUF1561)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.0      0.49   7.9e+02     358     388 ..     348     378 ..     343     383 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 0.49
     PF07598 358 vkrsLPpdfqlteeWikRLyeiarsttkeae 388
                 v r LP  fq+ e   kRL  i  s t+e++
  AAS81022.1 348 VGRALPQGFQVDERAFKRLEAIVLSMTPEER 378
                 5699********************9998766 PP

>> PF01935  Domain of unknown function DUF87
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.3       1.3   2.1e+03      33      43 ..     108     118 ..     103     125 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 1.3
     PF01935  33 GsGKSntvavL 43 
                 GsGK++t+a L
  AAS81022.1 108 GSGKTTTAAKL 118
                 9*******988 PP

>> PF02894  Oxidoreductase family, C-terminal alpha/beta domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.84   1.4e+03      70     100 ..      85     115 ..      69     117 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.84
                 ..EEESTTTCSCCEE.EEEEEEE---EEEEE CS
     PF02894  70 rqrqvaeateledaavsvlnlefgsgkvatl 100
                 + +  +++ +l+d  v++l +  gsgk++t+
  AAS81022.1  85 ALGGEPKHPQLKDRNVWFLVGLQGSGKTTTA 115
                 4566788999999999************998 PP

>> PF07472  Fucose-binding lectin II (PA-IIL)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.89   1.4e+03      36      92 ..     107     163 ..      97     166 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.89
                 -------EE-----EE-----EEEEEEE---B-B---EEEEETTTEEEEEE--B--- CS
     PF07472  36 tgkgtddknlgtkvlnsgsGkvrveviangkpsklrsrqvtlekkvnlaivgaedga 92 
                 +g+g+  +  +   +  g+G+  + v a+ +  + r +   l +kv++ ++  +dg+
  AAS81022.1 107 QGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRVLGEKVGVPVLEVQDGE 163
                 677777777777789999*******************************99999996 PP

>> PF09965  Uncharacterized protein conserved in bacteria (DUF2199)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.81   1.3e+03     111     144 ..     111     144 ..      78     147 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.81
     PF09965 111 eetlalevdvhlradgqRPkivLhdgdheLvidq 144
                 ++t+a +  +  + +g RP +v  d++ + +++q
  AAS81022.1 111 KTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQ 144
                 5688889999999*************99988887 PP

>> PF01202  Shikimate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.1       2.3   3.7e+03      26      68 ..      38      77 ..       2      85 .. 0.66
   2 ?    2.3   0.4      0.55   8.9e+02       2      15 ..     108     121 ..     107     125 .. 0.86
   3 ?    0.1   0.0       2.6   4.2e+03      34      62 ..     351     378 ..     347     405 .. 0.81

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 2.3
                HHHHH----HHHHHHH---HHHHHHHHHHHHHHCTSSSEEEE- CS
     PF01202 26 liekrtgmsiaeifeeegeeaFrelElevleelleeenaViat 68
                lie  ++ ++a+ f ee  e  r l ++vle+l+   ++V+at
  AAS81022.1 38 LIEADVNLEVARAFVEEVRE--RALGRKVLESLTPA-EVVLAT 77
                46666666666666666555..66666666666666.566666 PP

  == domain 2    score: 2.3 bits;  conditional E-value: 0.55
                 T---HHHHHHHHHH CS
     PF01202   2 GaGKstvGkllAka 15 
                 G+GK+t++  lA  
  AAS81022.1 108 GSGKTTTAAKLALY 121
                 9*********9965 PP

  == domain 3    score: 0.1 bits;  conditional E-value: 2.6
                 -HHHHHHH---HHHHHHHHHHHHHHCTSS CS
     PF01202  34 siaeifeeegeeaFrelElevleelleee 62 
                   ++ f+  +e aF +lE+ vl   +ee+
  AAS81022.1 351 ALPQGFQ-VDERAFKRLEAIVLSMTPEER 378
                 5667776.67999******9999888775 PP

>> PF01555  DNA methylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0       1.9     3e+03     201     212 ..     395     406 ..     394     410 .. 0.86

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.9
                 ----HHHHHHHT CS
     PF01555 201 GSGtTavaakel 212
                 GSGtT++++++l
  AAS81022.1 395 GSGTTVQEVNRL 406
                 9*******9988 PP

>> PF00481  Protein phosphatase 2C
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.1       2.1   3.3e+03     144     175 ..     385     416 ..     379     418 .. 0.83

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 2.1
                 SHHHHHHHHH----EE-TTTEE---BSBSB-- CS
     PF00481 144 nedEreRIeeaggsvsngngRvngsLavsRal 175
                 n + r+RI +  g+  ++++R+++ ++ ++al
  AAS81022.1 385 NASRRRRIAKGSGTTVQEVNRLVKAFEETKAL 416
                 677899**8877776669*******9999997 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (434 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       467  (0.0392042); expected 238.2 (0.02)
Passed bias filter:                      359  (0.0301377); expected 238.2 (0.02)
Passed Vit filter:                        62  (0.00520484); expected 11.9 (0.001)
Passed Fwd filter:                        62  (0.00520484); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              62  [number of targets reported over threshold]
# CPU time: 0.36u 0.04s 00:00:00.40 Elapsed: 00:00:00
# Mc/sec: 2602.68
//