# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30722.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAS81657.1  [L=61]
Description: tthe0 AAS81657.1 GIB00176CH01 "SSU ribosomal protein S14P"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      4e-23   83.1   5.3    4.6e-23   83.0   3.7    1.1  1  PF00253  Ribosomal protein S14p/S29e
  ------ inclusion threshold ------
        3.7    9.3   0.4        4.6    8.9   0.3    1.1  1  PF04981  NMD3 family
        7.8    9.7   0.9        9.1    9.5   0.6    1.2  1  PF08209  Sgf11 (transcriptional regulation protein)
         10    8.5   0.1         12    8.3   0.1    1.1  1  PF02207  Putative zinc finger in N-recognin (UBR box)
         13    8.4   0.7         16    8.2   0.5    1.2  1  PF10217  Uncharacterized conserved protein (DUF2039)
         15    7.5   2.1         30    6.6   1.4    1.6  1  PF04570  Protein of unknown function (DUF581)
         17    7.8   0.3         34    6.9   0.1    1.5  1  PF02017  CIDE-N domain
         19    7.7   0.1         35    6.8   0.1    1.4  1  PF02184  HAT (Half-A-TPR) repeat
         21    7.7   0.5         51    6.5   0.0    1.7  1  PF00097  Zinc finger, C3HC4 type (RING finger)
         28    7.4   0.5         47    6.7   0.1    1.6  1  PF07776  Zinc-finger associated domain (zf-AD)
         30    6.5   0.6         29    6.5   0.4    1.2  1  PF04808  Citrus tristeza virus (CTV) P23 protein
         35    7.2   0.1         56    6.6   0.0    1.3  1  PF03061  Thioesterase superfamily
         35    7.1   0.5         41    6.9   0.3    1.3  1  PF10690  Myticin pre-proprotein from the mussel
         37    6.8   0.0         57    6.2   0.0    1.4  1  PF03703  Bacterial membrane flanked domain
         37    6.7   0.2         37    6.7   0.2    1.1  1  PF01155  Hydrogenase expression/synthesis hypA family
         39    6.5   6.1         16    7.8   2.4    1.8  1  PF05484  LRV protein FeS4 cluster
         40    6.3   0.0         38    6.4   0.0    1.2  1  PF11819  Domain of unknown function (DUF3338)
         41    6.6   1.6         42    6.5   0.2    1.6  1  PF05129  Transcription elongation factor Elf1 like
         45    6.6   0.3         75    5.9   0.2    1.4  1  PF07525  SOCS box
         51    6.4   0.2         63    6.1   0.1    1.2  1  PF00684  DnaJ central domain (4 repeats)
         51    6.5   0.6    3.9e+02    3.7   0.1    1.9  2  PF00643  B-box zinc finger
         61    6.0   2.7         37    6.7   0.1    1.8  1  PF00037  4Fe-4S binding domain
         70    6.3   0.7    3.7e+02    4.0   0.5    1.9  1  PF11571  Mediator complex subunit 27
         74    5.8   1.5    1.1e+02    5.2   1.0    1.4  1  PF01781  Ribosomal L38e protein family
         75    5.8   0.0    1.1e+02    5.3   0.0    1.3  1  PF05930  Prophage CP4-57 regulatory protein (AlpA)
    1.1e+02    4.9   0.0    1.2e+02    4.8   0.0    1.1  1  PF06364  Protein of unknown function (DUF1068)
    1.2e+02    5.1   2.2    1.6e+02    4.7   0.1    2.0  1  PF01258  Prokaryotic dksA/traR C4-type zinc finger
    1.4e+02    3.6   0.2    1.5e+02    3.6   0.2    1.0  1  PF03348  Serine incorporator (Serinc)
    1.7e+02    4.7   5.2    3.1e+02    3.9   3.5    1.7  1  PF01907  Ribosomal protein L37e
    2.3e+02    3.7   2.9         67    5.4   0.1    1.5  1  PF00641  Zn-finger in Ran binding protein and others
    2.3e+02    4.2   0.0    3.2e+02    3.7   0.0    1.3  1  PF09135  Alb1
    2.7e+02    4.1   0.1    4.2e+02    3.5   0.0    1.3  1  PF11387  Protein of unknown function (DUF2795)
    2.9e+02    4.1   2.5    1.8e+02    4.8   0.5    1.7  1  PF12172  Rubredoxin-like zinc ribbon domain (DUF35_N)
      3e+02    2.0   0.5    3.3e+02    1.8   0.3    1.0  1  PF04615  Utp14 protein
      3e+02    4.6   1.5    3.9e+02    4.2   1.0    1.4  1  PF06749  Protein of unknown function (DUF1218)
    3.1e+02    4.1   0.0    6.2e+02    3.1   0.0    1.5  1  PF10685  Stress-induced bacterial acidophilic repeat motif
    3.3e+02    4.0   0.4    5.8e+02    3.2   0.3    1.3  1  PF02202  Tachykinin family
    3.6e+02    3.1   0.1    3.9e+02    3.0   0.1    1.1  1  PF01831  Peptidase C16 family
    4.7e+02    2.5   0.1      7e+02    1.9   0.0    1.2  1  PF12415  Poxvirus DNA dependent RNA polymerase
    5.9e+02    2.6   1.7    1.1e+03    1.8   1.1    1.5  1  PF11781  RNA polymerase I-specific transcription initiation 
    8.7e+02    2.3   5.9    2.6e+03    0.8   4.2    1.8  1  PF06827  Zinc finger found in FPG and IleRS
    9.4e+02    1.4   2.1    4.9e+02    2.4   0.2    1.4  1  PF04502  Family of unknown function (DUF572)
    1.4e+03    1.9   0.1    2.3e+03    1.2   0.1    1.3  1  PF10511  Trappin protein transglutaminase binding domain
    1.9e+03    1.6   2.0    3.7e+03    0.7   1.4    1.4  1  PF11664  Protein of unknown function (DUF3264)


Domain and alignment annotation for each model:
>> PF00253  Ribosomal protein S14p/S29e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.0   3.7     2e-26   4.6e-23       5      55 .]      10      60 ..       6      60 .. 0.92

  Alignments for each domain:
  == domain 1    score: 83.0 bits;  conditional E-value: 2e-26
     PF00253  5 klprkssytrgrnrCvltGrprgvirkfgLcRicFRelAskgllpGfkKas 55
                ++++ ++++r ++rCv++Gr r+v+r fgLcRic+RelA+kg+lpG++Kas
  AAS81657.1 10 AKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS 60
                4555669******************************************98 PP

>> PF04981  NMD3 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.3     0.002       4.6       1      22 [.      24      46 ..      24      55 .. 0.77

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.002
     PF04981  1 CvrCGkeiek.lieglCedClle 22
                CvrCG++ +     glC+ Cl+e
  AAS81657.1 24 CVRCGRARSVyRFFGLCRICLRE 46
                *****9544414559******98 PP

>> PF08209  Sgf11 (transcriptional regulation protein)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.5   0.6     0.004       9.1      67      94 ..      18      45 ..       4      50 .. 0.82

  Alignments for each domain:
  == domain 1    score: 9.5 bits;  conditional E-value: 0.004
     PF08209 67 sskyfeCenCgrdvsanrfaahlqrCls 94
                   y +C  Cgr  s  rf    + Cl 
  AAS81657.1 18 VRAYTRCVRCGRARSVYRFFGLCRICLR 45
                567****************998888886 PP

>> PF02207  Putative zinc finger in N-recognin (UBR box)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.1    0.0054        12      11      39 ..      19      51 ..       8      55 .. 0.76

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.0054
     PF02207 11 qlvyrCktCsk....detsviCleCfskscHkg 39
                 +  rC  C+      +  ++C  C ++  Hkg
  AAS81657.1 19 RAYTRCVRCGRarsvYRFFGLCRICLRELAHKG 51
                56679****99544455599*****99999986 PP

>> PF10217  Uncharacterized conserved protein (DUF2039)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.5    0.0069        16      48      81 ..      15      47 ..       3      53 .. 0.72

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0069
     PF10217 48 KYkalkeekkCnkCekktvkkayhklCdaCakel 81
                K+k  +  ++C++C +      +  lC+ C +el
  AAS81657.1 15 KFKV-RAYTRCVRCGRARSVYRFFGLCRICLREL 47
                4443.45689999998776677888999997765 PP

>> PF04570  Protein of unknown function (DUF581)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   1.4     0.013        30       9      30 ..      29      50 ..      21      53 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.013
     PF04570  9 easeeehfLesCflCkkkLgeg 30
                +a++ + f   C +C ++L+++
  AAS81657.1 29 RARSVYRFFGLCRICLRELAHK 50
                5667789************985 PP

>> PF02017  CIDE-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.1     0.015        34       3      31 ..      23      52 ..      21      54 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.015
                EEEEEEESSSSSE.E-EEESSHHHHHHHHH CS
     PF02017  3 kpvkvralkrkvk.kgvaassleellsKvl 31
                ++v+  ++++  + +g++  +l el +K++
  AAS81657.1 23 RCVRCGRARSVYRfFGLCRICLRELAHKGQ 52
                899999999998846*************86 PP

>> PF02184  HAT (Half-A-TPR) repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1     0.016        35       5      12 ..      29      36 ..      27      39 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.016
     PF02184  5 RAReiYeR 12
                RAR++Y  
  AAS81657.1 29 RARSVYRF 36
                ******64 PP

>> PF00097  Zinc finger, C3HC4 type (RING finger)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.023        51       1      12 [.      40      51 ..      40      55 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.023
                ETTTTSSBSSEE CS
     PF00097  1 CriCleeaeepn 12
                CriCl e + + 
  AAS81657.1 40 CRICLRELAHKG 51
                *****9988765 PP

>> PF07776  Zinc-finger associated domain (zf-AD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.1     0.021        47       1      11 [.      39      48 ..      39      60 .. 0.70

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.021
     PF07776  1 vCRlClseeee 11
                +CR+Cl +e +
  AAS81657.1 39 LCRICL-RELA 48
                5*****.5443 PP

>> PF04808  Citrus tristeza virus (CTV) P23 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.4     0.013        29      48      75 ..       5      31 ..       1      51 [. 0.84

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.013
     PF04808 48 alirknsyqgarfrariigvcvdcgrkh 75
                ali k++ +  +f+ r    cv cgr  
  AAS81657.1  5 ALIEKAK-RTPKFKVRAYTRCVRCGRAR 31
                6777754.6789*************975 PP

>> PF03061  Thioesterase superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.025        56      49      67 ..      17      35 ..      12      38 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.025
                EEEEEEEEEEEESSEEEEE CS
     PF03061 49 vltvearvlrlgrtsavve 67
                ++++++r++r gr++ v++
  AAS81657.1 17 KVRAYTRCVRCGRARSVYR 35
                589************9997 PP

>> PF10690  Myticin pre-proprotein from the mussel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.3     0.018        41      46      66 ..      15      35 ..       9      51 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.018
     PF10690 46 llhkgklCkClrCsreespla 66
                +++ + +  C+rC r++s ++
  AAS81657.1 15 KFKVRAYTRCVRCGRARSVYR 35
                577889999****99987665 PP

>> PF03703  Bacterial membrane flanked domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0     0.025        57      42      68 ..      33      56 ..      29      60 .. 0.73

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.025
     PF03703 42 lqrllglgtlkidtagggkaevkipll 68
                + r++gl+ +++   ++     ++p++
  AAS81657.1 33 VYRFFGLCRICLRELAHK---GQLPGV 56
                57*********9755544...455555 PP

>> PF01155  Hydrogenase expression/synthesis hypA family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.2     0.016        37      66      93 ..      17      44 ..       1      52 [. 0.79

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.016
     PF01155 66 evpvsvrCreCgeeveleeraleCpkCg 93
                +v++ +rC +Cg+  ++ +    C  C 
  AAS81657.1 17 KVRAYTRCVRCGRARSVYRFFGLCRICL 44
                5678889999999999999988898885 PP

>> PF05484  LRV protein FeS4 cluster
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   2.4    0.0071        16      32      47 ..      22      37 ..      14      41 .. 0.90

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0071
                -B-SSS----HHHHHH CS
     PF05484 32 dsCvadrsarridRFF 47
                 +Cv+  +ar + RFF
  AAS81657.1 22 TRCVRCGRARSVYRFF 37
                69************** PP

>> PF11819  Domain of unknown function (DUF3338)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.017        38      54      70 ..      38      54 ..       5      57 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.017
     PF11819 54 ELkklClrEAELtGklp 70
                 L ++ClrE    G+lp
  AAS81657.1 38 GLCRICLRELAHKGQLP 54
                6889******999*999 PP

>> PF05129  Transcription elongation factor Elf1 like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.2     0.018        42      10      34 ..       9      33 ..       2      36 .. 0.71

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.018
                ----------SS----TTT--SS-E CS
     PF05129 10 pkkkkkkeklpkvFeCpfCnhkksv 34
                + k+  k k++    C +C+ ++sv
  AAS81657.1  9 KAKRTPKFKVRAYTRCVRCGRARSV 33
                4555666778888899999998887 PP

>> PF07525  SOCS box
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.2     0.033        75       7      24 ..      39      56 ..      38      59 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.033
     PF07525  7 LCRlaIRrslgrerleai 24
                LCR+++R   ++ +l+++
  AAS81657.1 39 LCRICLRELAHKGQLPGV 56
                9******98888776655 PP

>> PF00684  DnaJ central domain (4 repeats)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.1     0.028        63      42      73 ..       9      41 ..       4      46 .. 0.71

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.028
     PF00684 42 keqrapggvvqsqqtCeaCkGkgkii.ekkkCk 73
                k +r+p + v+  ++C +C+   +++     C+
  AAS81657.1  9 KAKRTPKFKVRAYTRCVRCGRARSVYrFFGLCR 41
                566788999999999999987766654445555 PP

>> PF00643  B-box zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.96   2.2e+03       4      12 ..      22      30 ..      19      37 .. 0.62
   2 ?    3.7   0.1      0.17   3.9e+02      25      36 ..      39      51 ..      38      52 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.96
     PF00643  4 rkCpeHeek 12
                ++C ++++ 
  AAS81657.1 22 TRCVRCGRA 30
                567777754 PP

  == domain 2    score: 3.7 bits;  conditional E-value: 0.17
     PF00643 25 lCedCllee.Hkg 36
                lC+ Cl e  Hkg
  AAS81657.1 39 LCRICLRELaHKG 51
                8*****9999975 PP

>> PF00037  4Fe-4S binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.1     0.016        37       6      13 ..      22      29 ..      18      29 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.016
                TTS---TH CS
     PF00037  6 ekCigCGa 13
                 +C++CG+
  AAS81657.1 22 TRCVRCGR 29
                79*****5 PP

>> PF11571  Mediator complex subunit 27
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.5      0.16   3.7e+02      57      76 ..      39      58 ..      15      60 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.16
     PF11571 57 pCkkCkkllsskalLPpvir 76
                 C+ C + l +k +LP v++
  AAS81657.1 39 LCRICLRELAHKGQLPGVRK 58
                48888888888999998887 PP

>> PF01781  Ribosomal L38e protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   1.0      0.05   1.1e+02      22      38 ..       5      20 ..       2      31 .. 0.75

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.05
     PF01781 22 vkvkknkkkitKfKvRc 38
                + ++k k++  KfKvR+
  AAS81657.1  5 ALIEKAKRT-PKFKVRA 20
                556666665.9****96 PP

>> PF05930  Prophage CP4-57 regulatory protein (AlpA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.047   1.1e+02       5      30 ..      29      54 ..      25      59 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.047
     PF05930  5 rlkeviqltGlsrstiYrlikdgeFP 30
                r + v ++ Gl+r ++ +l  +g+ P
  AAS81657.1 29 RARSVYRFFGLCRICLRELAHKGQLP 54
                78899**********99999999999 PP

>> PF06364  Protein of unknown function (DUF1068)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.055   1.2e+02     143     173 ..       2      32 ..       1      35 [. 0.88

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.055
     PF06364 143 aekalveqkkltslweerarekGykeGaikp 173
                 a kal+e+ k t +++ ra  +  + G  ++
  AAS81657.1   2 ARKALIEKAKRTPKFKVRAYTRCVRCGRARS 32 
                 689****************999999887765 PP

>> PF01258  Prokaryotic dksA/traR C4-type zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.1     0.071   1.6e+02       3      10 ..      21      28 ..      19      31 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.071
                EEE-TTT- CS
     PF01258  3 ygsCedCG 10
                y +C +CG
  AAS81657.1 21 YTRCVRCG 28
                67788887 PP

>> PF03348  Serine incorporator (Serinc)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.2     0.066   1.5e+02      46      79 ..       4      36 ..       1      44 [. 0.79

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.066
     PF03348 46 pgvekklkkkilkfieeskvdCselvgysaVyRv 79
                + +++k k+ ++kf  ++ ++C  +    +VyR+
  AAS81657.1  4 KALIEKAKR-TPKFKVRAYTRCVRCGRARSVYRF 36
                556666666.9999999999**99*999****97 PP

>> PF01907  Ribosomal protein L37e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   3.5      0.14   3.1e+02      11      24 ..      17      30 ..      11      43 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.14
     PF01907 11 nkkthtlCrrCGrr 24
                + +  t+C rCGr 
  AAS81657.1 17 KVRAYTRCVRCGRA 30
                566789******95 PP

>> PF00641  Zn-finger in Ran binding protein and others
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.1      0.03        67      19      25 ..      22      28 ..      20      32 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.03
                SB-SSS- CS
     PF00641 19 tkCvaCq 25
                t+Cv+C+
  AAS81657.1 22 TRCVRCG 28
                79****7 PP

>> PF09135  Alb1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.14   3.2e+02       1      23 [.       1      23 [.       1      34 [. 0.85

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.14
     PF09135  1 Mpsknsinkpklklslhsraasl 23
                M+ k+ i k k++++ + ra ++
  AAS81657.1  1 MARKALIEKAKRTPKFKVRAYTR 23
                999**********9999999876 PP

>> PF11387  Protein of unknown function (DUF2795)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.18   4.2e+02      10      20 ..       3      13 ..       1      14 [. 0.87

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.18
     PF11387 10 KdeLidhArrs 20
                +++Li++A+r+
  AAS81657.1  3 RKALIEKAKRT 13
                899******96 PP

>> PF12172  Rubredoxin-like zinc ribbon domain (DUF35_N)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.5     0.079   1.8e+02      12      20 ..      22      30 ..      20      37 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.079
     PF12172 12 qrCreCGrv 20
                +rC  CGr 
  AAS81657.1 22 TRCVRCGRA 30
                799999997 PP

>> PF04615  Utp14 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.3      0.14   3.3e+02     222     245 ..       8      31 ..       3      38 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.14
     PF04615 222 akakRikKIKSKkYrrvkkKekek 245
                  kakR  K K ++Y r  +  +++
  AAS81657.1   8 EKAKRTPKFKVRAYTRCVRCGRAR 31 
                 69**************99988887 PP

>> PF06749  Protein of unknown function (DUF1218)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   1.0      0.17   3.9e+02      13      27 ..      18      32 ..      13      54 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.17
     PF06749 13 vnvasgClccgkals 27
                v ++++C++cg+a s
  AAS81657.1 18 VRAYTRCVRCGRARS 32
                6799******99844 PP

>> PF10685  Stress-induced bacterial acidophilic repeat motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.27   6.2e+02      11      17 ..      45      51 ..      44      51 .. 0.94

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.27
     PF10685 11 rEiGrKG 17
                rE ++KG
  AAS81657.1 45 RELAHKG 51
                9*****9 PP

>> PF02202  Tachykinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.3      0.25   5.8e+02       6      10 ..      35      39 ..      35      39 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.25
                HH--- CS
     PF02202  6 qFvGL 10
                +F+GL
  AAS81657.1 35 RFFGL 39
                7***9 PP

>> PF01831  Peptidase C16 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.1      0.17   3.9e+02     106     120 ..      15      29 ..       9      43 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.17
     PF01831 106 sfkvyanwrclkcdm 120
                  fkv a  rc++c+ 
  AAS81657.1  15 KFKVRAYTRCVRCGR 29 
                 69***********86 PP

>> PF12415  Poxvirus DNA dependent RNA polymerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.31     7e+02      20      28 ..       4      12 ..       4      13 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.31
     PF12415 20 nalIEstke 28
                +alIE +k+
  AAS81657.1  4 KALIEKAKR 12
                69***9997 PP

>> PF11781  RNA polymerase I-specific transcription initiation factor Rrn7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   1.1      0.48   1.1e+03      29      33 ..      24      28 ..      21      31 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.48
     PF11781 29 CtrCG 33
                C+rCG
  AAS81657.1 24 CVRCG 28
                ****9 PP

>> PF06827  Zinc finger found in FPG and IleRS
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   4.2       1.1   2.6e+03       3      11 ..      23      31 ..      21      45 .. 0.81

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 1.1
     PF06827  3 kCpRCwnyi 11
                +C RC++  
  AAS81657.1 23 RCVRCGRAR 31
                7*****965 PP

>> PF04502  Family of unknown function (DUF572)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.2      0.22   4.9e+02      73      90 ..      33      50 ..      30      54 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.22
     PF04502 73 ifrFyikCtkClaeitfk 90
                ++rF   C  Cl e+  k
  AAS81657.1 33 VYRFFGLCRICLRELAHK 50
                8*************9877 PP

>> PF10511  Trappin protein transglutaminase binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.1         1   2.3e+03       6      10 ..      50      54 ..      50      54 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 1
     PF10511  6 KGqlp 10
                KGqlp
  AAS81657.1 50 KGQLP 54
                88887 PP

>> PF11664  Protein of unknown function (DUF3264)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   1.4       1.6   3.7e+03      13      27 ..      23      37 ..      23      37 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 1.6
     PF11664 13 RdaarlrrlratssF 27
                R++++ r + ++++F
  AAS81657.1 23 RCVRCGRARSVYRFF 37
                899999999999888 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (61 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       365  (0.0306414); expected 238.2 (0.02)
Passed bias filter:                      320  (0.0268637); expected 238.2 (0.02)
Passed Vit filter:                        46  (0.00386165); expected 11.9 (0.001)
Passed Fwd filter:                        46  (0.00386165); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              44  [number of targets reported over threshold]
# CPU time: 0.12u 0.04s 00:00:00.16 Elapsed: 00:00:01
# Mc/sec: 1097.44
//