# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30725.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAS81963.1  [L=361]
Description: tthe0 pilT.2 GIB00176CH01 "pili retraction protein pilT"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.3e-42  148.3   0.1    2.1e-42  147.6   0.1    1.3  1  PF00437  Type II/IV secretion system protein
     0.0018   19.7   0.1     0.0092   17.3   0.0    1.9  1  PF10412  Type IV secretion-system coupling protein DNA-bindi
      0.006   19.1   0.1      0.011   18.2   0.0    1.6  1  PF01935  Domain of unknown function DUF87
      0.008   18.0   0.0      0.065   15.0   0.0    2.5  1  PF06414  Zeta toxin
     0.0084   18.3   0.1       0.03   16.5   0.0    1.9  1  PF01580  FtsK/SpoIIIE family
     0.0086   18.5   0.0       0.02   17.3   0.0    1.7  1  PF03205  Molybdopterin guanine dinucleotide synthesis protei
  ------ inclusion threshold ------
      0.024   16.3   0.0       0.11   14.1   0.0    1.8  1  PF10236  Mitochondrial ribosomal death-associated protein 3
      0.032   16.5   0.0      0.064   15.5   0.0    1.5  1  PF03029  Conserved hypothetical ATP binding protein
      0.033   16.5   0.5        1.4   11.2   0.1    2.4  2  PF03266  Protein of unknown function, DUF265
      0.042   16.7   0.0        0.1   15.5   0.0    1.8  1  PF00004  ATPase family associated with various cellular acti
      0.075   15.2   0.0       0.14   14.4   0.0    1.3  1  PF00265  Thymidine kinase
       0.09   15.0   0.0       0.25   13.6   0.0    1.8  1  PF05729  NACHT domain
      0.099   15.8   0.0        0.2   14.8   0.0    1.5  1  PF08477  Miro-like protein
       0.13   14.8   0.0       0.19   14.2   0.0    1.3  1  PF04851  Type III restriction enzyme, res subunit
       0.17   13.3   0.3       0.39   12.1   0.1    1.4  1  PF03215  Rad17 cell cycle checkpoint protein
       0.17   13.5   0.0       0.34   12.5   0.0    1.6  1  PF07693  KAP family P-loop domain
       0.18   14.1   0.0       0.29   13.4   0.0    1.4  1  PF01637  Archaeal ATPase
       0.41   12.7   0.0       0.81   11.8   0.0    1.5  1  PF00448  SRP54-type protein, GTPase domain
       0.65   12.1   0.0        1.2   11.2   0.0    1.5  1  PF02492  CobW/HypB/UreG, nucleotide-binding domain
       0.69   12.0   0.0        1.1   11.4   0.0    1.4  1  PF00270  DEAD/DEAH box helicase
       0.71   12.6   0.0        2.3   10.9   0.0    1.9  1  PF02875  Mur ligase family, glutamate ligase domain
       0.87   11.7   0.0        2.1   10.5   0.0    1.6  1  PF00158  Sigma-54 interaction domain
       0.92   11.3   0.1        1.6   10.5   0.1    1.4  1  PF01078  Magnesium chelatase, subunit ChlI
        1.1   11.1   0.0        1.9   10.3   0.0    1.3  1  PF08433  Chromatin associated protein KTI12
        1.3   11.9   0.0        2.6   10.9   0.0    1.5  1  PF00910  RNA helicase
        1.3   10.7   0.1        2.8    9.7   0.0    1.7  1  PF06745  KaiC
        1.7    9.6   0.1         99    3.8   0.0    2.1  2  PF05872  Bacterial protein of unknown function (DUF853)
        1.9   10.1   0.0        3.8    9.1   0.0    1.5  1  PF09848  Uncharacterized conserved protein (DUF2075)
        2.8   10.0   0.1        4.6    9.3   0.0    1.4  1  PF02283  Cobinamide kinase / cobinamide phosphate guanyltran
        2.9    9.7   0.0        4.7    9.0   0.0    1.3  1  PF02562  PhoH-like protein
        3.1    9.4   0.0        4.8    8.7   0.0    1.2  1  PF11602  ATPase P4 of dsRNA bacteriophage phi-12
        3.1    9.1   0.1        6.8    8.0   0.0    1.5  1  PF03308  ArgK protein
        3.3   10.5   0.1        9.8    9.0   0.0    1.8  1  PF09333  ATG C terminal domain
        4.6    9.0   0.0        8.2    8.2   0.0    1.4  1  PF02463  RecF/RecN/SMC N terminal domain
          5    9.4   0.0        8.3    8.7   0.0    1.3  1  PF04830  Possible hemagglutinin (DUF637)
        5.1    9.5   0.0         14    8.1   0.0    1.7  1  PF01035  6-O-methylguanine DNA methyltransferase, DNA bindin
        5.2    8.8   0.0         10    7.9   0.0    1.5  1  PF02955  Prokaryotic glutathione synthetase, ATP-grasp domai
        5.6    9.3   0.0         14    8.1   0.0    1.6  1  PF07728  AAA domain (dynein-related subfamily)
        7.4    8.2   0.3    1.3e+02    4.1   0.0    2.4  2  PF03668  P-loop ATPase protein family
        7.6    8.7   0.0         20    7.4   0.0    1.7  1  PF01443  Viral (Superfamily 1) RNA helicase
        8.5    8.2   0.0         30    6.4   0.0    1.9  1  PF05368  NmrA-like family
        9.1    8.3   0.2         39    6.2   0.1    1.8  1  PF01656  CobQ/CobB/MinD/ParA nucleotide binding domain
         11    8.1   0.0         36    6.4   0.0    1.8  1  PF05707  Zonular occludens toxin (Zot)
         12    7.1   0.0         15    6.7   0.0    1.2  1  PF06911  Senescence-associated protein
         12    6.9   0.0         24    5.9   0.0    1.4  1  PF10443  RNA12 protein
         13    7.4   0.0         24    6.6   0.0    1.3  1  PF04548  AIG1 family
         14    7.9   0.0         21    7.2   0.0    1.3  1  PF00485  Phosphoribulokinase / Uridine kinase family
         15    7.7   0.0         32    6.7   0.0    1.6  1  PF05127  Putative ATPase (DUF699)
         17    5.7   0.0         23    5.2   0.0    1.1  1  PF02689  Helicase
         17    7.2   0.0         32    6.4   0.0    1.4  1  PF03976  Polyphosphate kinase 2 (PPK2)
         17    7.3   0.0         30    6.6   0.0    1.3  1  PF00488  MutS domain V
         18    7.3   0.0         37    6.3   0.0    1.4  1  PF00625  Guanylate kinase
         20    6.7   0.0         34    5.9   0.0    1.4  1  PF05673  Protein of unknown function (DUF815)
         22    7.8   0.1         70    6.2   0.0    1.9  1  PF02186  TFIIE beta subunit core domain
         24    7.0   0.0         34    6.5   0.0    1.3  1  PF00006  ATP synthase alpha/beta family, nucleotide-binding 
         25    6.6   0.0         50    5.6   0.0    1.5  1  PF00693  Thymidine kinase from herpesvirus
         28    7.1   0.0         71    5.8   0.0    1.8  1  PF02817  e3 binding domain
         32    6.9   0.0         52    6.3   0.0    1.5  1  PF00849  RNA pseudouridylate synthase
         35    5.6   0.0         74    4.5   0.0    1.4  1  PF02456  Adenovirus IVa2 protein
         35    7.0   0.0         73    5.9   0.0    1.5  1  PF08284  Retroviral aspartyl protease
         36    6.6   0.0         68    5.7   0.0    1.4  1  PF01583  Adenylylsulphate kinase
         42    6.8   0.1    2.5e+02    4.3   0.0    2.1  1  PF07196  Flagellin hook IN motif
         45    5.4   0.0         78    4.7   0.0    1.3  1  PF00931  NB-ARC domain
         46    6.0   0.0         95    5.0   0.0    1.5  1  PF01695  IstB-like ATP binding protein
         59    4.7   0.0    1.3e+02    3.6   0.0    1.5  1  PF09818  Predicted ATPase of the ABC class
         77    6.6   0.0    1.7e+02    5.5   0.0    1.6  1  PF00630  Filamin/ABP280 repeat
         77    5.9   0.1    1.7e+02    4.8   0.0    1.6  1  PF06470  SMC proteins Flexible Hinge Domain
         84    4.2   0.0    1.5e+02    3.3   0.0    1.3  1  PF03666  Nitrogen Permease regulator of amino acid transport
      1e+02    5.7   0.2    3.3e+02    4.0   0.0    1.8  1  PF11757  Suppressor of RNA silencing P21-like
    1.1e+02    4.2   0.0    2.1e+02    3.2   0.0    1.4  1  PF01094  Receptor family ligand binding region
    1.1e+02    4.4   0.0    1.7e+02    3.8   0.0    1.2  1  PF10250  GDP-fucose protein O-fucosyltransferase
    1.2e+02    3.6   0.0    1.6e+02    3.1   0.0    1.1  1  PF05482  Serendipity locus alpha protein (SRY-A)
    1.3e+02    4.1   0.0      2e+02    3.4   0.0    1.2  1  PF00735  Septin
    1.6e+02    3.9   0.0    2.3e+02    3.4   0.0    1.2  1  PF02958  Domain of unknown function (DUF227)
    1.7e+02    4.9   1.0    4.1e+02    3.7   0.3    1.8  1  PF04508  Viral A-type inclusion protein repeat
      2e+02    3.2   0.0    3.2e+02    2.5   0.0    1.2  1  PF07651  ANTH domain
      2e+02    4.2   0.0      4e+02    3.2   0.0    1.4  1  PF07278  Protein of unknown function (DUF1441)
    2.2e+02    3.1   0.1    5.2e+02    1.9   0.1    1.5  1  PF05049  Interferon-inducible GTPase (IIGP)
    2.3e+02    2.8   0.0    3.9e+02    2.0   0.0    1.3  1  PF02534  TraG/TraD family
    2.6e+02    3.5   0.0    5.3e+02    2.5   0.0    1.4  1  PF11561  Single strand annealing-weakened 1
    2.7e+02    2.4   0.0    3.8e+02    2.0   0.0    1.2  1  PF03068  Protein-arginine deiminase (PAD)
    2.7e+02    3.9   0.0      5e+02    3.0   0.0    1.4  1  PF00350  Dynamin family
    3.5e+02    3.6   0.0    7.8e+02    2.5   0.0    1.5  1  PF00631  GGL domain
    3.6e+02    3.6   0.0    7.7e+02    2.5   0.0    1.4  1  PF05419  GUN4-like
    3.7e+02    2.9   0.0    7.7e+02    1.9   0.0    1.5  1  PF05678  VQ motif
    7.8e+02    1.5   0.0    1.4e+03    0.6   0.0    1.3  1  PF03415  Clostripain family


Domain and alignment annotation for each model:
>> PF00437  Type II/IV secretion system protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.6   0.1   1.8e-45   2.1e-42      23     271 ..      18     263 ..       7     276 .. 0.82

  Alignments for each domain:
  == domain 1    score: 147.6 bits;  conditional E-value: 1.8e-45
     PF00437  23 kvsdihvnrpervwvervdglelreipelskaalerlisrvaalskqeisekrplldarlp...ekgerfrvvllPvveeeklviRkkssaslsledla 118
                 ++sd+++      +++  ++++  e + l++++++rl++ ++   +q+i e+++ ld +++   ++ +r++v l         v+R   sa  s+e+l+
  AAS81963.1  18 GASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEEKELDFSFSlpgKGRYRVNVFLQ--RGSVGGVLRVVPSAVKSFEELG 114
                 56666655554455566667888999999**********************999999988876666667776664..4446679996666666999999 PP

     PF00437 119 akgalkkklaevlrqavqargnilvsGgTgSGKttllnallaeinkd.derivtiEDpvElqlegenqvqlnak..kakvtfadllraaLRqrPDrilv 214
                       k++ae+  ++   rg++lv+G+TgSGK+t+l +++++in++   +ivtiEDp+E   +++ ++  + +  + + +f+++lr++LRq PD+ilv
  AAS81963.1 115 L----PKNIAEIAMSP---RGLVLVTGPTGSGKSTTLASMIDYINERkACHIVTIEDPIEFFHKHKRAIVNQREigSDTKSFHKALRSVLRQAPDVILV 206
                 6....57889999999...****************************6678***********9999988666668888999****************** PP

     PF00437 215 GEiRdkealei.lrAvntGHlgslsTlHansaasalerLeqlgkeleadeirslilav 271
                 GE+Rd e++ + + A++tGHl+ ++TlH+nsa ++++r+ +   e +++++r ++ + 
  AAS81963.1 207 GEMRDYETIAAaITAAETGHLV-MGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNN 263
                 **********99**********.*******************9886666555554433 PP

>> PF10412  Type IV secretion-system coupling protein DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   17.3   0.0   7.9e-06    0.0092      18      49 ..     130     161 ..     117     172 .. 0.90

  Alignments for each domain:
  == domain 1    score: 17.3 bits;  conditional E-value: 7.9e-06
     PF10412  18 ilivGttGtGKtqalrelldqirargdraiiy 49 
                 +l++G tG+GK+++l +++d i++r+  +i++
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVT 161
                 689***********************999985 PP

>> PF01935  Domain of unknown function DUF87
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   18.2   0.0   9.5e-06     0.011      27      56 ..     131     160 ..     129     260 .. 0.92

  Alignments for each domain:
  == domain 1    score: 18.2 bits;  conditional E-value: 9.5e-06
     PF01935  27 AilgsTGsGKSntvavLleellekkgatil 56 
                 ++ g TGsGKS+t a+++  + e+k ++i+
  AAS81963.1 131 LVTGPTGSGKSTTLASMIDYINERKACHIV 160
                 6899******************99999998 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   15.0   0.0   5.6e-05     0.065      17      66 ..     128     179 ..     117     207 .. 0.75

  Alignments for each domain:
  == domain 1    score: 15.0 bits;  conditional E-value: 5.6e-05
     PF06414  17 kavllgGqpGAGKtslaellleelaagnivri..daDelrkyhpayrelekk 66 
                  +vl+ G++G+GK++++  +++ ++++++ +i   +D +  +h + r++ ++
  AAS81963.1 128 GLVLVTGPTGSGKSTTLASMIDYINERKACHIvtIEDPIEFFHKHKRAIVNQ 179
                 5899*********************777776633568888888888887765 PP

>> PF01580  FtsK/SpoIIIE family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   16.5   0.0   2.5e-05      0.03      31      60 ..     120     149 ..     104     161 .. 0.79

  Alignments for each domain:
  == domain 1    score: 16.5 bits;  conditional E-value: 2.5e-05
                 -EEEGGGS-SEEEE-----------HHHHH CS
     PF01580  31 lvadlvkaphlLiaGatgsGKStflrtLil 60 
                  ++ +++   +L+ G tgsGKSt+l ++i 
  AAS81963.1 120 AEIAMSPRGLVLVTGPTGSGKSTTLASMID 149
                 45555666689*****************96 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   17.3   0.0   1.7e-05      0.02       3      34 ..     130     161 ..     128     195 .. 0.89

  Alignments for each domain:
  == domain 1    score: 17.3 bits;  conditional E-value: 1.7e-05
                 EEEE-E-----HHHHHHHHHHHHH----EEEE CS
     PF03205   3 vlvvGpkdsGKTTliekllnilkergyrvavv 34 
                 vlv+Gp++sGK+T++ +++ ++ er+  ++v 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERKACHIVT 161
                 89********************9998766554 PP

>> PF10236  Mitochondrial ribosomal death-associated protein 3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.1   0.0   9.5e-05      0.11      26      73 ..     130     178 ..     113     192 .. 0.85

  Alignments for each domain:
  == domain 1    score: 14.1 bits;  conditional E-value: 9.5e-05
     PF10236  26 vvltGekgsGKSvlLaqamayAlek.gwvVlhvpeaeelvngtteyaps 73 
                 v++tG++gsGKS++La ++ y  e     ++++ ++ e+ ++++    +
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERkACHIVTIEDPIEFFHKHKRAIVN 178
                 789****************999988356799999999999999876655 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.5   0.0   5.5e-05     0.064       1      32 [.     132     162 ..     132     188 .. 0.87

  Alignments for each domain:
  == domain 1    score: 15.5 bits;  conditional E-value: 5.5e-05
     PF03029   1 vvGpaGsGKttfvgalseilelskrsvavvNL 32 
                 v+Gp GsGK+t + +++++++++ + +++v +
  AAS81963.1 132 VTGPTGSGKSTTLASMIDYINER-KACHIVTI 162
                 89*******************99.77777755 PP

>> PF03266  Protein of unknown function, DUF265
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   0.1    0.0012       1.4       2      26 ..     130     154 ..     129     165 .. 0.87
   2 ?    2.4   0.0      0.61   7.1e+02     110     147 ..     185     222 ..     164     241 .. 0.79

  Alignments for each domain:
  == domain 1    score: 11.2 bits;  conditional E-value: 0.0012
                 EEEE-------HHHHHHHHHH-... CS
     PF03266   2 vfiTGppgvGKtTlvkkvlellkse 26 
                 v++TGp g+GK+T +  +++ ++++
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINER 154
                 78***************99999765 PP

  == domain 2    score: 2.4 bits;  conditional E-value: 0.61
                 G-HHHHHHHHHHHTTTSEEEEE--SS--SHHHHHHHT- CS
     PF03266 110 kskkfieaveevlssekpvlatihrrkdlalveeirkr 147
                  +k+f++a++ vl++ + v+ +   r+++ ++  i   
  AAS81963.1 185 DTKSFHKALRSVLRQAPDVILVGEMRDYETIAAAITAA 222
                 56889999999999999999888888766666666655 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.5   0.0   8.6e-05       0.1       1      67 [.     130     210 ..     130     273 .. 0.81

  Alignments for each domain:
  == domain 1    score: 15.5 bits;  conditional E-value: 8.6e-05
                 EEEE-------HHHHHHHHHHTT.............CEEEEEETTSSS.SST.HCHHHHHHHHHHHHHHTSSEEEEEETGG CS
     PF00004   1 vllyGppGtGKTllakavakelg.............vefleisgsell.skyvgesekkirelfkeakekapsvlfiDEid 67 
                 vl++Gp G GK+++  +++  ++             +ef+      ++ +  +g   k +++ ++++ ++ap v+++ E+ 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINerkachivtiedpIEFFHKHKRAIVnQREIGSDTKSFHKALRSVLRQAPDVILVGEMR 210
                 799*****************98644443343444445588888888885669**************99999*****99985 PP

>> PF00265  Thymidine kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.4   0.0   0.00012      0.14       3     127 ..     129     248 ..     128     257 .. 0.64

  Alignments for each domain:
  == domain 1    score: 14.4 bits;  conditional E-value: 0.00012
     PF00265   3 ielilgpmfsGKsteLirrvkryklakkkvvvikaakdnRykeakvvthdgisleakksktssledikealeke.vdvvgvDEaqFfkqdivelsekla 100
                 + l++gp  sGKst+L  ++   +  +k + +++ +    + ++    +  +++++  s+t+s+++  + + ++  dv++v E + ++   +  + + a
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYIN-ERKACHIVTIEDPIEFFHK--HKRAIVNQREIGSDTKSFHKALRSVLRQaPDVILVGEMRDYE--TIAAAITAA 222
                 5799************99987555.5567888777766666654..2333333333356677777766666666599******99888..333333344 PP

     PF00265 101 negkkvivagLdtdFerklFesilkll 127
                 ++g ++++  L+t+ + ++ + i+ ++
  AAS81963.1 223 ETG-HLVMGTLHTNSAPETIDRIVDVF 248
                 444.44445666666666666655555 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.6   0.0   0.00022      0.25       2      29 ..     129     156 ..     128     202 .. 0.86

  Alignments for each domain:
  == domain 1    score: 13.6 bits;  conditional E-value: 0.00022
     PF05729   2 tvilqGeaGsGKTtLlqklasawakgkl 29 
                 +v+++G+ GsGK+t l+++++ + ++k 
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYINERKA 156
                 699******************9998875 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.8   0.0   0.00018       0.2       2      91 ..     130     217 ..     129     226 .. 0.75

  Alignments for each domain:
  == domain 1    score: 14.8 bits;  conditional E-value: 0.00018
                 EEEE--TT---HHHHHHHH-----....--SSSSSCEEEEEEEGGG-EEE.EEEEE----.-TTTTT-HHHHHSSCEEEEEE-CCGHHHHHH CS
     PF08477   2 vvvvGdkgvGKssllsqlvgeefpkkklpeeikgdtlavktlevdvdtel.lelwdlggr.eelkkehelllkkadaillvydltdeeslee 91 
                 v+v G +g+GKs+ l++++   ++    ++  +  t+ + +++  + ++  ++ +++g + + ++k    +l++a  ++lv  ++d+e+++ 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINE----RKACHIVTIEDPIEFFHKHKRAiVNQREIGSDtKSFHKALRSVLRQAPDVILVGEMRDYETIAA 217
                 789****************88888....5555555555554455554444377777775436677777777999999999*99***999876 PP

>> PF04851  Type III restriction enzyme, res subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.2   0.0   0.00017      0.19      28     125 ..     130     228 ..     109     261 .. 0.73

  Alignments for each domain:
  == domain 1    score: 14.2 bits;  conditional E-value: 0.00017
                 --EEE------HHHHHHHHHHH-S....-EEEEESSHHHHHHHHHH------T...T---B----B---SEEEEEHHHHH................... CS
     PF04851  28 glivmaTGtGKTlvaasliarlar....kflflvprkelleqaleefkkfeskkiefekkniavakkdklfgeeqkkskdkeekkkkdkeiilttiqkl 122
                 +l+  +TG+GK+ ++as+i ++ +    +++ + + +e   + ++++   ++ +i   +k+  ++  ++++ +  +++   e+++ +++   +t++ + 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINErkacHIVTIEDPIEFFHKHKRAI--VNQREIGSDTKSF-HKALRSVLRQAPDVILVGEMRDYETIAAAITAAETG 225
                 67889************999999899999999999999999999999..3333333333333.444446777777777777777777777777776666 PP

                 ... CS
     PF04851 123 hka 125
                 h  
  AAS81963.1 226 HLV 228
                 655 PP

>> PF03215  Rad17 cell cycle checkpoint protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.1   0.1   0.00033      0.39      45      65 ..     127     147 ..     117     156 .. 0.83

  Alignments for each domain:
  == domain 1    score: 12.1 bits;  conditional E-value: 0.00033
     PF03215  45 krillltGPsGcgKsTtvkvl 65 
                 + ++l+tGP+G+gKsTt+  +
  AAS81963.1 127 RGLVLVTGPTGSGKSTTLASM 147
                 4499*************9877 PP

>> PF07693  KAP family P-loop domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   0.0   0.00029      0.34      12      57 ..     119     162 ..     115     269 .. 0.91

  Alignments for each domain:
  == domain 1    score: 12.5 bits;  conditional E-value: 0.00029
     PF07693  12 lseptlatpiviglyGkWGsGKssllnlledelkefkpvrflfaei 57 
                 + e ++++   + ++G+ GsGKs+ l+ ++d+++e+  +  ++++i
  AAS81963.1 119 IAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINER--KACHIVTI 162
                 5667778888999***********************..55666555 PP

>> PF01637  Archaeal ATPase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.4   0.0   0.00025      0.29      11      86 ..     119     197 ..     116     258 .. 0.74

  Alignments for each domain:
  == domain 1    score: 13.4 bits;  conditional E-value: 0.00025
                 HHHHHHH..-SEEEEE--TT---HHHHHHHHHH-..---.HHHHH------HHHHHHHH.......HHHS-SHHHHHHHH CS
     PF01637  11 leeilerepnsiiviyGprrsGKTaLlkeileelkekgk.rvvyyinlreefeskleefie...eeeekkklakalgial 86 
                 + ei+ + p+ ++++ Gp +sGK++ l  ++   +e +  + v +++  e f++++++ ++     +++k++ kal++ l
  AAS81963.1 119 IAEIAMS-PRGLVLVTGPTGSGKSTTLASMIDYINERKAcHIVTIEDPIEFFHKHKRAIVNqreIGSDTKSFHKALRSVL 197
                 6666666.899*****************9999996666656666666555555555555445533444455555554444 PP

>> PF00448  SRP54-type protein, GTPase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.0   0.00069      0.81       3      31 ..     129     157 ..     127     167 .. 0.82

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00069
                 EEEEE-------TTTHCCHHHHHHCTS-- CS
     PF00448   3 villvGlqGaGKTTtlaKLAallkkegkk 31 
                 ++l+ G++G+GK Ttla + +++++++  
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYINERKAC 157
                 5899***************9999887654 PP

>> PF02492  CobW/HypB/UreG, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   0.0     0.001       1.2       3      35 ..     130     164 ..     128     210 .. 0.82

  Alignments for each domain:
  == domain 1    score: 11.2 bits;  conditional E-value: 0.001
                 EEEE-------HHHHHHHHH..CT...S-EEEEES CS
     PF02492   3 tvltGflGsGKTtLleklle..knraglkiavivn 35 
                 + +tG+ GsGK+t l ++++  ++r+   i  i+ 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDyiNERKACHIVTIED 164
                 679****************9887777777766665 PP

>> PF00270  DEAD/DEAH box helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.4   0.0   0.00094       1.1      14      44 ..     127     163 ..     117     298 .. 0.76

  Alignments for each domain:
  == domain 1    score: 11.4 bits;  conditional E-value: 0.00094
                 -SEEEEEE------HHHHHHHHHHHHHCTT.......T CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.......x RF
     PF00270  14 ggdvlvaaeTGsGKTlaflipvlqilyetl.......p 44 
                 +g vlv ++TGsGK++     ++++++e++       +
  AAS81963.1 127 RGLVLVTGPTGSGKSTTL-ASMIDYINERKachivtiE 163
                 6789**********8764.5566777777744444440 PP

>> PF02875  Mur ligase family, glutamate ligase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.9   0.0     0.002       2.3      14      80 ..     148     208 ..     140     218 .. 0.77

  Alignments for each domain:
  == domain 1    score: 10.9 bits;  conditional E-value: 0.002
                 TEEEE-.T--SCCCHHHHHHHHHHC-S.S-EEEEE-E-SC-HHHHHHTHHHHHHHHCCCSCEEEEE-S CS
     PF02875  14 vtvidD.yahnpdslsaalkalreiapdkrlilvfgpggelgertrefhdefgrlasaladslvvlgd 80 
                 + +i+  +a ++  ++  ++++    ++ ++ +v +   e g++t++fh+ +  ++ ++ d+++v g+
  AAS81963.1 148 IDYINErKACHIVTIEDPIEFF----HKHKRAIVNQR--EIGSDTKSFHKALRSVLRQAPDVILV-GE 208
                 6678888888888888888888....88899999998..*******************6655555.44 PP

>> PF00158  Sigma-54 interaction domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.0    0.0018       2.1      17      56 ..     121     162 ..     109     166 .. 0.73

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.0018
                 HHHTS-.S-EEEE-------HH.HHHHHHHHSTTTTS--EEE CS
     PF00158  17 kvaktd.ltvlitGesGtGKel.lAraiheaskrkkkpfvav 56 
                 ++a ++   vl+tG +G+GK++ lA++i   ++rk+ ++v++
  AAS81963.1 121 EIAMSPrGLVLVTGPTGSGKSTtLASMIDYINERKACHIVTI 162
                 4444443679**********8527888877888877777765 PP

>> PF01078  Magnesium chelatase, subunit ChlI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.1    0.0014       1.6      12      47 ..     117     152 ..     113     244 .. 0.65

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.0014
     PF01078  12 kraleiaaaGgHnlllvGppGsGKtm.lakrlpsllp 47 
                 k+  eia + +  +l++Gp GsGK+  la+ +  +  
  AAS81963.1 117 KNIAEIAMSPRGLVLVTGPTGSGKSTtLASMIDYI-N 152
                 677899999999************86155544443.3 PP

>> PF08433  Chromatin associated protein KTI12
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.3   0.0    0.0016       1.9       3      44 ..     129     170 ..     128     206 .. 0.70

  Alignments for each domain:
  == domain 1    score: 10.3 bits;  conditional E-value: 0.0016
     PF08433   3 LvvltGlPssGKstvakeLakaleeegrsvvvisdeslgiek 44 
                 Lv++tG   sGKst  + + ++++e++   +v  ++ +++ +
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFH 170
                 9**********************9976665555555555333 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.9   0.0    0.0022       2.6       1      30 [.     130     155 ..     130     188 .. 0.76

  Alignments for each domain:
  == domain 1    score: 10.9 bits;  conditional E-value: 0.0022
     PF00910   1 iwlyGpsgeGKStlakeLakallkklklkk 30 
                 ++++Gp+g GKSt+  ++++ + +     k
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINE----RK 155
                 5799*************9988873....33 PP

>> PF06745  KaiC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   0.0    0.0024       2.8      20      74 ..     128     186 ..     114     272 .. 0.73

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.0024
     PF06745  20 rvvlitGepGtGKtifalqFlikgaeeygepgvfvtveesa......edlrenakslgwdl 74 
                  +vl+tG +G+GK++  +  +i  ++e  + + +vt+e +       +  + n +++g d+
  AAS81963.1 128 GLVLVTGPTGSGKSTTLAS-MIDYINE-RKACHIVTIEDPIeffhkhKRAIVNQREIGSDT 186
                 579**********987665.5566666.799******999844444433333344445554 PP

>> PF05872  Bacterial protein of unknown function (DUF853)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.087     1e+02      25      44 ..     131     150 ..     116     160 .. 0.82
   2 ?    3.8   0.0     0.085        99     346     391 ..     214     259 ..     186     289 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.087
     PF05872  25 liaGatGtGktvtLqvlaes 44 
                 l++G tG Gk  tL  + + 
  AAS81963.1 131 LVTGPTGSGKSTTLASMIDY 150
                 79************998765 PP

  == domain 2    score: 3.8 bits;  conditional E-value: 0.085
     PF05872 346 dveeaiteLgvGealvsvLdekGaPsiveralvvpPasrlgplsee 391
                  ++ ait+ ++G+ ++++L+ + aP+ ++r + v P+ + + +  +
  AAS81963.1 214 TIAAAITAAETGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQ 259
                 46789*************************9988888776666555 PP

>> PF09848  Uncharacterized conserved protein (DUF2075)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.0    0.0032       3.8       3      55 ..     129     180 ..     127     217 .. 0.65

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.0032
     PF09848   3 vilvtGvaGtGKtvvalnllaeledseeertavflsgN.hplvkvlrealakkl 55 
                 ++lvtG  G+GK+  + +++  +  +e++  +++ +++  ++ ++ ++a+ +++
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYI--NERKACHIVTIEDpIEFFHKHKRAIVNQR 180
                 79******************999..33333333333330344445555554444 PP

>> PF02283  Cobinamide kinase / cobinamide phosphate guanyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0    0.0039       4.6       1      79 [.     130     207 ..     130     268 .. 0.64

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.0039
     PF02283   1 ilvtGgarSGKSefAeklaaesg.kkvvYiAtaeafDeemaeRiarHrerRpaeWetveepldlaealeeeeeeevvLvD 79 
                 +lvtG++ SGKS+   +++   + +k ++i t e   e +++  ++  ++R+ + +t   +++l ++l++++  +v+Lv 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINeRKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAP--DVILVG 207
                 79**********988888855541555888887766555555555555566666666666666666665554..466665 PP

>> PF02562  PhoH-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0041       4.7      18      61 ..     126     168 ..     117     225 .. 0.76

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0041
     PF02562  18 kndivfaiGpaGtGKTylavalavealkkkkvkriiltRpavea 61 
                  + +v+++Gp+G+GK+  ++a  ++ ++++k  +i+ +   +e 
  AAS81963.1 126 PRGLVLVTGPTGSGKST-TLASMIDYINERKACHIVTIEDPIEF 168
                 56799**********85.67778999999999999998877765 PP

>> PF11602  ATPase P4 of dsRNA bacteriophage phi-12
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.0    0.0042       4.8     112     131 ..     128     147 ..     119     178 .. 0.78

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0042
                 --EEEE-------H------ CS
     PF11602 112 GlvvvvGktgsGkskaLnek 131
                 Glv+v+G tgsGks +L   
  AAS81963.1 128 GLVLVTGPTGSGKSTTLASM 147
                 9*************777654 PP

>> PF03308  ArgK protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.0    0.0059       6.8      32      57 ..     130     155 ..     122     170 .. 0.77

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0059
                 E--B-------HHHHHH---HHHH-- CS
     PF03308  32 vGltGvPGaGkstlveklikelrrrG 57 
                 v +tG  G+Gkst++  +i  + +r 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERK 155
                 569**************998876653 PP

>> PF09333  ATG C terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0085       9.8      29      65 ..     170     206 ..     154     222 .. 0.86

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0085
     PF09333  29 kdtaqtllavasevheqkglqgavgavlkaiPiavvr 65 
                 ++ ++++++ ++ ++++k+ ++a+++vl+++P +++ 
  AAS81963.1 170 HKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILV 206
                 56678999999999******************99985 PP

>> PF02463  RecF/RecN/SMC N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0     0.007       8.2      24      49 ..     127     152 ..     105     182 .. 0.80

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.007
                 -SEEEE--------HHHHHHHHHH-- CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463  24 ksftaivGpNGSGKsnvldAilFvLG 49 
                 +++  ++Gp GSGKs  l ++  ++ 
  AAS81963.1 127 RGLVLVTGPTGSGKSTTLASMIDYIN 152
                 567899*********99998865555 PP

>> PF04830  Possible hemagglutinin (DUF637)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.0    0.0072       8.3      36     108 ..     214     280 ..     206     288 .. 0.82

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0072
     PF04830  36 alkggavaaltAGltsgitdeagslakagvknngnklakqadastasglgqqaaallaqalisagvntainGG 108
                 ++ ++++aa t+ l+ g       l    ++++ + +++ +  ++++++  q++++l+  l++ ++ +a  GG
  AAS81963.1 214 TIAAAITAAETGHLVMGT------LHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG 280
                 556666666666666664......444557899***************************************9 PP

>> PF01035  6-O-methylguanine DNA methyltransferase, DNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.0     0.012        14       6      51 ..     195     241 ..     189     245 .. 0.84

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.012
                 HHHHHHHH.S-----EEHHHHHHHTT-TTTTTT-----TT-SSCTTC CS
     PF01035   6 rvlealre.IpyGrvttYgeiAkalgkpkaaraVgralaanplaliv 51 
                 +vl+++   I  G++  Y+ iA+a+ +++  + V   l++n  + ++
  AAS81963.1 195 SVLRQAPDvILVGEMRDYETIAAAITAAETGHLVMGTLHTNSAPETI 241
                 566665555999**************************999987665 PP

>> PF02955  Prokaryotic glutathione synthetase, ATP-grasp domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.0    0.0086        10      63     122 ..     258     320 ..     212     332 .. 0.78

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0086
                 HHTT-----EEEEE--GGGG---EEE...EEE---B-SEEE-----------TT------EEE CS
     PF02955  63 llteegeepviaqkylpeikeGDkRi...lllnGepigalaRipaegevRsNlaaggraeate 122
                 +  +++   v+ q+ lp++  G + +   l++   ++ al R  +++++Rs +++gg+    +
  AAS81963.1 258 VQLSNNLVAVLTQQLLPKAFGGGRVLayeLMIATPAVRALIREGKTHQLRSVIQTGGQYGMIT 320
                 44455556799999999998776554555799999999*******************976655 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.0     0.012        14       2      29 ..     130     159 ..     129     229 .. 0.77

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.012
     PF07728   2 vlLvGppGtgKselaerlaeal..nrevey 29 
                 vl+ Gp+G+gKs+   ++   +  ++  ++
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYIneRKACHI 159
                 7899*********99999998854444444 PP

>> PF03668  P-loop ATPase protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.11   1.3e+02       3      23 ..     129     149 ..     128     152 .. 0.90
   2 ?    1.2   0.0       0.9     1e+03     233     272 ..     295     334 ..     285     344 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.11
     PF03668   3 lvivsGlsGaGksvalraled 23 
                 lv+v+G +G+Gks++l ++ d
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMID 149
                 79*************998876 PP

  == domain 2    score: 1.2 bits;  conditional E-value: 0.9
     PF03668 233 pslkregksyltiaiGctGGkhrsvaiaeqladyfrsdgk 272
                  +l regk++   ++  tGG++  +++   lad++r++  
  AAS81963.1 295 RALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLI 334
                 56778899888888889******************98865 PP

>> PF01443  Viral (Superfamily 1) RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0     0.017        20       2      33 ..     131     161 ..     130     222 .. 0.73

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.017
     PF01443   2 vvhGvpGcGKStlirkllrtltvnrptaelrt 33 
                 +v+G  G+GKSt + + ++     r+++ ++t
  AAS81963.1 131 LVTGPTGSGKSTTLASMIDY-INERKACHIVT 161
                 799**********9999987.23333344444 PP

>> PF05368  NmrA-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.026        30      33      76 ..     190     233 ..     130     249 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.026
                 ---HHHHHHHSTTEEE----T-HHHHHHHH----EEEE---TT- CS
     PF05368  33 kselakslkaaGvelvegdlddkeslvealkgvdvvfsvttfve 76 
                 +++l   l +a+ +++ g++ d e +++a++ +++  +v++  +
  AAS81963.1 190 HKALRSVLRQAPDVILVGEMRDYETIAAAITAAETGHLVMGTLH 233
                 5666677899999999****************999888887655 PP

>> PF01656  CobQ/CobB/MinD/ParA nucleotide binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.1     0.034        39       2      26 ..     130     154 ..     129     160 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.034
                 EEE---TT---HHHHHHHHHHHHH- CS
                 xxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF01656   2 aiaggkGGvGKTtlaanLaralakr 26 
                 +++ g  G+GK+t+ a+++ ++++r
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINER 154
                 5677889***********9998886 PP

>> PF05707  Zonular occludens toxin (Zot)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.031        36       3      34 ..     130     161 ..     128     216 .. 0.70

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.031
     PF05707   3 ylvtGkpGsGKtleaVskdilpalk.eGrkvit 34 
                 +lvtG  GsGK+    s+ i    + + ++++t
  AAS81963.1 130 VLVTGPTGSGKSTTLASM-IDYINErKACHIVT 161
                 69**********999888.55533324555555 PP

>> PF06911  Senescence-associated protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.013        15     152     181 ..     207     236 ..     164     266 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.013
     PF06911 152 PnvedYsgvvakliaaGsGqlikGilwcgd 181
                  ++ dY+  +a + aa +G+l+ G l++  
  AAS81963.1 207 GEMRDYETIAAAITAAETGHLVMGTLHTNS 236
                 5678********************998754 PP

>> PF10443  RNA12 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.021        24      13      33 ..     123     143 ..     117     163 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.021
     PF10443  13 eenvntfivvkgPrGSGkkeL 33 
                 + ++  +++v+gP GSGk+  
  AAS81963.1 123 AMSPRGLVLVTGPTGSGKSTT 143
                 5567889***********864 PP

>> PF04548  AIG1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.021        24       3      22 ..     130     149 ..     128     164 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.021
                 EEEE-------HHHHHHH-- CS
     PF04548   3 ivlvGktgnGkSaTgNsilg 22 
                 +++ G tg+GkS+T  s+++
  AAS81963.1 130 VLVTGPTGSGKSTTLASMID 149
                 5778**********999875 PP

>> PF00485  Phosphoribulokinase / Uridine kinase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0     0.018        21       3      29 ..     131     157 ..     129     199 .. 0.74

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.018
                 EE---------THHHHHHHHHHH---- CS
     PF00485   3 gvagsSGaGkttvarklesifgrekvk 29 
                  v+g  G+Gk+t+ + + + +++ k  
  AAS81963.1 131 LVTGPTGSGKSTTLASMIDYINERKAC 157
                 69***********99999999854433 PP

>> PF05127  Putative ATPase (DUF699)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.027        32       2      30 ..     132     160 ..     131     208 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.027
     PF05127   2 ltAdRGRGKSaalGlalaalvaegksnil 30 
                 +t+  G GKS++l+ ++  + +++ ++i+
  AAS81963.1 132 VTGPTGSGKSTTLASMIDYINERKACHIV 160
                 78999**************9999998886 PP

>> PF02689  Helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0      0.02        23      58      83 ..     125     150 ..     100     162 .. 0.69

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.02
     PF02689  58 lPFsaylitGtAGaGKstsiqtlaen 83 
                  P    l+tG  G+GKst+++ + + 
  AAS81963.1 125 SPRGLVLVTGPTGSGKSTTLASMIDY 150
                 5777889***********97765443 PP

>> PF03976  Polyphosphate kinase 2 (PPK2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.028        32      33      70 ..     129     167 ..     111     183 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.028
                 EEEEE--TT------HHHHHTTS-GG.G-EEEE--S--H CS
     PF03976  33 vvifegrDaAGKgGaikrvtealnpr.varvvalkaPte 70 
                 +v+  g  + GK  +++ +++++n r ++++v+++ P e
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYINERkACHIVTIEDPIE 167
                 67889999***************987369******9976 PP

>> PF00488  MutS domain V
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.026        30      34      60 ..     119     145 ..     104     152 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.026
                 EEEECTTSS.EEEEE--TT---HHHHH CS
     PF00488  34 dveleeeksrlllitGpNmgGKStylr 60 
                   e+  + + l+l+tGp  +GKSt l 
  AAS81963.1 119 IAEIAMSPRGLVLVTGPTGSGKSTTLA 145
                 555555666799************885 PP

>> PF00625  Guanylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.032        37       5      33 ..     130     159 ..     126     165 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.032
                 EEEE------HHHHHHHHHHHSTTT--.-- CS
     PF00625   5 ivlvGpsgvGkstlkkaLldelpekfg.is 33 
                 + ++Gp+g+Gkst    ++d+ +e+ +  +
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERKAcHI 159
                 6679****************9999986344 PP

>> PF05673  Protein of unknown function (DUF815)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.029        34      56      87 ..     130     162 ..     115     180 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.029
     PF05673  56 vLLwGarGtGKSslvkallneyaeeg.Lrliev 87 
                 vL++G  G+GKS+++ +++  ++e++  +++ +
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERKaCHIVTI 162
                 89**************99999888765566655 PP

>> PF02186  TFIIE beta subunit core domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0      0.06        70       2      35 ..     139     166 ..     138     177 .. 0.72

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.06
     PF02186   2 hkftvLakiVeYikerHlegddePltveeildel 35 
                  k+t+La  ++Yi er      ++  +  i+d +
  AAS81963.1 139 GKSTTLASMIDYINER------KACHIVTIEDPI 166
                 689*************......555555555555 PP

>> PF00006  ATP synthase alpha/beta family, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0      0.03        34      18      48 ..     130     161 ..     127     258 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.03
                 xxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxx RF
     PF00006  18 tlipGafgcGktvisqslsknsnsdai.iyvg 48 
                 +l+ G+ g Gk++ ++s++ ++n+     +v 
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINERKAcHIVT 161
                 6899******************9665533333 PP

>> PF00693  Thymidine kinase from herpesvirus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.043        50       1      35 [.     134     170 ..     134     207 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.043
                 -------HHHHHCCCCTT-.T..TTEEEE---HHHHH CS
     PF00693   1 GayGiGKtttaralaaasear..gpvlyvpEPmayWr 35 
                 G+ G GK+tt+  +++  ++r   +++ +++P+++  
  AAS81963.1 134 GPTGSGKSTTLASMIDYINERkaCHIVTIEDPIEFFH 170
                 899*************999996445788889998765 PP

>> PF02817  e3 binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.061        71       3      15 ..     288     300 ..     286     320 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.061
                 CCBSHHHHHHHHH CS
     PF02817   3 vfasPaaRkLAae 15 
                 ++a+Pa+R L +e
  AAS81963.1 288 MIATPAVRALIRE 300
                 78********998 PP

>> PF00849  RNA pseudouridylate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.045        52     145     163 ..     293     311 ..     203     312 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.045
     PF00849 145 lveleletGrkhQiRahla 163
                  v+  +++G++hQ+R  ++
  AAS81963.1 293 AVRALIREGKTHQLRSVIQ 311
                 578889*********8765 PP

>> PF02456  Adenovirus IVa2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.063        74      90     108 ..     130     148 ..     115     156 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.063
     PF02456  90 gvvygptgsGksqllrnll 108
                 ++v gptgsGks  l +++
  AAS81963.1 130 VLVTGPTGSGKSTTLASMI 148
                 5799********9998776 PP

>> PF08284  Retroviral aspartyl protease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.063        73      10      35 ..     216     241 ..     209     245 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.063
     PF08284  10 vaaeevqeapdvvlGtflvnsiPatv 35 
                 +aa ++ e+  +v+Gt+  ns+P t+
  AAS81963.1 216 AAAITAAETGHLVMGTLHTNSAPETI 241
                 4678999****************987 PP

>> PF01583  Adenylylsulphate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.058        68       5      29 ..     130     154 ..     127     167 .. 0.69

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.058
                 EEEE-ETT---HHHHHHHHHHHHHT CS
     PF01583   5 vwltGlsgsGKstiavalekkLvek 29 
                 v++tG +gsGKst    +  +++e+
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINER 154
                 789********97544444455444 PP

>> PF07196  Flagellin hook IN motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0      0.22   2.5e+02      20      31 ..     141     152 ..     134     156 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.22
     PF07196  20 gdtlddladaIN 31 
                  +tl++ +d+IN
  AAS81963.1 141 STTLASMIDYIN 152
                 59********** PP

>> PF00931  NB-ARC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.067        78      19      38 ..     127     146 ..     118     158 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.067
                 SEEEEEE-------HHHHHH CS
     PF00931  19 lkvvglvGmgGvGKttlakq 38 
                 +++v + G  G+GK+t++++
  AAS81963.1 127 RGLVLVTGPTGSGKSTTLAS 146
                 578999********987665 PP

>> PF01695  IstB-like ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.082        95      50      62 ..     130     142 ..     124     200 .. 0.75

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.082
     PF01695  50 lvllGpsGvGKth 62 
                 ++++Gp+G GK+ 
  AAS81963.1 130 VLVTGPTGSGKST 142
                 7899*******84 PP

>> PF09818  Predicted ATPase of the ABC class
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0      0.12   1.3e+02     243     263 ..     126     146 ..     104     151 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.12
     PF09818 243 pkGitlIvGggyhGKsTLLeA 263
                 p+G++l++G    GKsT L +
  AAS81963.1 126 PRGLVLVTGPTGSGKSTTLAS 146
                 89**************98865 PP

>> PF00630  Filamin/ABP280 repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0      0.14   1.7e+02      68      97 ..      69      98 ..      17      99 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.14
                ----EEEEE--S----EEEEEEE---B-CT CS
     PF00630 68 edgtytvsYtpeepgkyrvsvkldgkhigg 97
                e+   + s+ +  +g+yrv+v+l+  ++gg
  AAS81963.1 69 EEKELDFSFSLPGKGRYRVNVFLQRGSVGG 98
                45578899999************9988886 PP

>> PF06470  SMC proteins Flexible Hinge Domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0      0.15   1.7e+02      17      69 ..     188     240 ..     183     276 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.15
     PF06470  17 gyekAveaalgnrlqaivvddeetakkiieflkkanagratflpldrikqkns 69 
                  ++kA+  +l ++ + i+v  + + + i   +  a +g++ +  l + +++++
  AAS81963.1 188 SFHKALRSVLRQAPDVILVGEMRDYETIAAAITAAETGHLVMGTLHTNSAPET 240
                 6889*****************************99999988877777666655 PP

>> PF03666  Nitrogen Permease regulator of amino acid transport activity 3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0      0.13   1.5e+02     123     192 ..     129     197 ..     120     219 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.13
     PF03666 123 vVFilnPplieynervdemYhnvvkklslaLkyeqsksdYvskeckkilklkekvkekskkleslyeeil 192
                 +V++  P+    + ++++m +++ ++ +     +++  ++  k  + i++ +e  +++ k++++ ++ +l
  AAS81963.1 129 LVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDT-KSFHKALRSVL 197
                 7889999999*******************************************55554.55555555444 PP

>> PF11757  Suppressor of RNA silencing P21-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.28   3.3e+02      62      87 ..     325     350 ..     319     353 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.28
     PF11757  62 lLkliRrklvrdkLgvrsiqdtfdfl 87 
                 l +l Rrkl+++++g+  + d  +f+
  AAS81963.1 325 LADLYRRKLITYEMGLARAVDPKEFM 350
                 66899**********99999888887 PP

>> PF01094  Receptor family ligand binding region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.18   2.1e+02      47      74 ..     124     151 ..     117     152 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.18
     PF01094  47 lksrgvvaviGpscssvsdavarlanlf 74 
                 +++rg v v Gp++s+ s+++a++ ++ 
  AAS81963.1 124 MSPRGLVLVTGPTGSGKSTTLASMIDYI 151
                 678999******************9875 PP

>> PF10250  GDP-fucose protein O-fucosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.15   1.7e+02     244     270 ..      41      67 ..      31      68 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.15
     PF10250 244 egkcPltpeevklllralgkpkttsvY 270
                  +  Pltp+e+++l  al ++k+++++
  AAS81963.1  41 TEYEPLTPQETRRLMYALMDEKQQRIF 67 
                 5667**********************9 PP

>> PF05482  Serendipity locus alpha protein (SRY-A)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.14   1.6e+02     401     449 ..     161     209 ..     142     219 .. 0.76

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.14
     PF05482 401 livqmGsvlaehfrlpvnyselsedGkrlhkdlililreclavvelsvl 449
                  i    +  ++h r  vn++e+  d k  hk l  +lr+   v+ +  +
  AAS81963.1 161 TIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEM 209
                 5555566778999************************998888776655 PP

>> PF00735  Septin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.17     2e+02       7      31 ..     130     154 ..     128     191 .. 0.72

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.17
     PF00735   7 lmvvGesglGkttlintlfetdlie 31 
                 ++v G  g Gk+t + +++     +
  AAS81963.1 130 VLVTGPTGSGKSTTLASMIDYINER 154
                 799************9998654443 PP

>> PF02958  Domain of unknown function (DUF227)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0       0.2   2.3e+02     127     186 ..     154     214 ..     140     242 .. 0.76

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.2
     PF02958 127 fHAaslalkeekpevfkqlkkglleedyvssakeefeelleellkaaleal.keelpelek 186
                   A+ +++ e+  e+f+++k+ +++++ + s+++ f + l+++l++a +++   e++++e 
  AAS81963.1 154 RKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVIlVGEMRDYET 214
                 56999******99******************977788888888888877641345555544 PP

>> PF04508  Viral A-type inclusion protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.3      0.36   4.1e+02       3      18 ..      59      74 ..      59      74 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.36
     PF04508  3 ldrlRrkIsdLekqLs 18
                +d+ +++I ++ek+L+
  AAS81963.1 59 MDEKQQRIFEEEKELD 74
                7999**********96 PP

>> PF07651  ANTH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.27   3.2e+02     113     161 ..     148     196 ..     132     200 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.27
                 HHHHHHHHHHHHHHSS-...CCCS---.....----TTT--HHHHHHHH CS
     PF07651 113 akyLderlefyrklkvdkgelereeegslvavedpnertlsmeklldki 161
                  +y++er  ++  +  d++e+  + ++++v +++  + t+s  k l+++
  AAS81963.1 148 IDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSV 196
                 68*************************9888888887788888888776 PP

>> PF07278  Protein of unknown function (DUF1441)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.35     4e+02      82     117 ..     169     204 ..     150     223 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.35
     PF07278  82 leketrqliPvsevrreysvlakavvqvLetlPDvL 117
                 + k +r ++   e+ +   ++ ka+  vL   PDv+
  AAS81963.1 169 FHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVI 204
                 6889999***************************86 PP

>> PF05049  Interferon-inducible GTPase (IIGP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.1      0.45   5.2e+02      38      52 ..     130     144 ..     115     158 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.45
                 EEEE-------HHHH CS
     PF05049  38 iavtGdsGnGkssFi 52 
                 + vtG +G+Gks+ +
  AAS81963.1 130 VLVTGPTGSGKSTTL 144
                 88**********865 PP

>> PF02534  TraG/TraD family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.33   3.9e+02      47      61 ..     130     144 ..     119     161 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.33
     PF02534  47 vlvvAptrsgKgvgv 61 
                 vlv +pt+sgK++ +
  AAS81963.1 130 VLVTGPTGSGKSTTL 144
                 89*********9865 PP

>> PF11561  Single strand annealing-weakened 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.46   5.3e+02      49      70 ..     253     274 ..     250     282 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.46
     PF11561  49 spnvriqLSnndlksLlkelrd 70 
                 + +vr+qLSnn + +L ++l +
  AAS81963.1 253 QEQVRVQLSNNLVAVLTQQLLP 274
                 5689**********99998865 PP

>> PF03068  Protein-arginine deiminase (PAD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.32   3.8e+02     148     191 ..     224     267 ..     182     310 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.32
                 ---EEE---S--TT-----HHHHHHHHHTGGG--EE---TTB-- CS
     PF03068 148 lgriligssfpksegrrlakvvrdflkaqqvqapvelysdwlsv 191
                  g +++g+ +++s    + ++v  f + qq q  v+l  + ++v
  AAS81963.1 224 TGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAV 267
                 68899999999*************************98777665 PP

>> PF00350  Dynamin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.43     5e+02       1      18 [.     130     147 ..     130     156 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.43
                 EEEE--TT---HHHHHHH CS
     PF00350   1 iavvGsqSaGKSSllnaL 18 
                 ++v+G   +GKS+ l ++
  AAS81963.1 130 VLVTGPTGSGKSTTLASM 147
                 689**********98776 PP

>> PF00631  GGL domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.67   7.8e+02      23      37 ..     141     155 ..     140     158 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.67
                 HHHHHHHHHHHHHHC CS
     PF00631  23 SkaaeelikYceqha 37 
                 S +++++i+Y+++++
  AAS81963.1 141 STTLASMIDYINERK 155
                 8899********987 PP

>> PF05419  GUN4-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.66   7.7e+02      15      41 ..      49      75 ..      46      78 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.66
                HHHHHHHHHH---HCHTS--HHHHCTS CS
     PF05419 15 eetarlllklagrekegwltvediekl 41
                +et+rl+ +l+++++++ +++e+  ++
  AAS81963.1 49 QETRRLMYALMDEKQQRIFEEEKELDF 75
                79**************99998876555 PP

>> PF05678  VQ motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.66   7.7e+02      10      18 ..     344     352 ..     343     352 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.66
     PF05678  10 tdpanFRal 18 
                 +dp +F++l
  AAS81963.1 344 VDPKEFMRL 352
                 8******86 PP

>> PF03415  Clostripain family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0       1.2   1.4e+03     134     156 ..     303     325 ..     301     329 .. 0.88

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.2
     PF03415 134 lpelsdaLesgesvdllgfDACl 156
                 + +l+++++ g +  ++ +DACl
  AAS81963.1 303 THQLRSVIQTGGQYGMITMDACL 325
                 56799999999999********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (361 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       455  (0.0381968); expected 238.2 (0.02)
Passed bias filter:                      432  (0.036266); expected 238.2 (0.02)
Passed Vit filter:                        87  (0.00730356); expected 11.9 (0.001)
Passed Fwd filter:                        86  (0.00721961); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              86  [number of targets reported over threshold]
# CPU time: 0.38u 0.06s 00:00:00.44 Elapsed: 00:00:00
# Mc/sec: 2050.96
//