hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_30727.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAS82166.1
Accession:      [none]
Description:    tthe0 AAS82166.1 GIB00176CH01 "SSU ribosomal protein S1P"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0047019  Nucleic acid-binding proteins                  413.0   3.1e-125   5
0048887  Nucleic acid-binding proteins                  398.9   1.3e-124   5
0050575  Nucleic acid-binding proteins                  358.9   8.5e-118   5
0047828  Nucleic acid-binding proteins                  396.7   3.8e-115   5
0040675  Nucleic acid-binding proteins                  388.7   9.5e-113   5
0051771  Nucleic acid-binding proteins                  385.2   1.1e-111   5
0052107  Nucleic acid-binding proteins                  354.7   1.7e-102   5
0049455  Nucleic acid-binding proteins                  338.3    1.5e-97   5
0049427  Nucleic acid-binding proteins                  336.1    6.9e-97   5
0051177  Nucleic acid-binding proteins                  283.2    1.1e-85   5
0038590  Nucleic acid-binding proteins                  273.8    3.6e-78   5
0046451  Nucleic acid-binding proteins                  243.0    4.4e-69   5
0047715  Nucleic acid-binding proteins                  218.1    8.6e-62   5

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0050575    1/5      11   130 ..     1   119 []    83.9  8.5e-27
0048887    1/5      19   105 ..     1    87 []    58.6  4.4e-17
0047828    1/5      20   105 ..     1    86 []    59.0  5.1e-15
0051771    1/5      22   105 ..     1    84 []    57.6  2.8e-15
0038590    1/5      25   105 ..     1    72 []    50.2  4.7e-13
0040675    1/5      25   110 ..     1    85 []    63.4    7e-17
0049455    1/5      28   106 ..     1    76 []    56.4  6.5e-15
0047715    1/5      29   103 ..     1    76 []    40.4  3.8e-10
0052107    1/5      29   113 ..     1    94 []    54.4  1.9e-14
0047019    1/5      30   118 ..     1   106 []    67.4  2.1e-19
0051177    1/5      30   107 ..     1    91 []    40.3  4.3e-11
0049427    1/5      33   110 ..     1    87 []    56.3  9.7e-15
0046451    1/5      38    97 ..     1    62 []    35.0  1.6e-08
0048887    2/5     108   189 ..     1    87 []    65.0  4.2e-19
0047828    2/5     109   189 ..     1    86 []    65.7  6.6e-17
0051771    2/5     111   189 ..     1    84 []    63.5  5.5e-17
0038590    2/5     114   189 ..     1    72 []    40.3  3.5e-10
0040675    2/5     114   194 ..     1    85 []    63.2  7.9e-17
0049455    2/5     117   190 ..     1    76 []    49.0  9.7e-13
0047715    2/5     118   187 ..     1    76 []    20.5  0.00022
0052107    2/5     118   197 ..     1    94 []    52.8  5.4e-14
0047019    2/5     119   202 ..     1   106 []    66.9    3e-19
0051177    2/5     119   190 ..     1    91 []    39.7  6.5e-11
0049427    2/5     122   194 ..     1    87 []    51.9  1.8e-13
0046451    2/5     127   181 ..     1    62 []    24.3  2.1e-05
0050575    2/5     134   194 ..    34   119 .]    33.5  4.1e-10
0048887    3/5     195   278 ..     1    87 []    88.7  1.3e-26
0047828    3/5     196   278 ..     1    86 []    86.8  7.2e-23
0051771    3/5     198   278 ..     1    84 []    85.1  2.8e-23
0038590    3/5     201   278 ..     1    72 []    61.7  2.1e-16
0040675    3/5     201   283 ..     1    85 []    88.7  3.5e-24
0050575    3/5     203   302 ..    16   119 .]    97.7  2.4e-31
0049455    3/5     204   279 ..     1    76 []    77.9  3.7e-21
0047715    3/5     205   278 ..     1    76 []    51.4  2.3e-13
0052107    3/5     205   286 ..     1    94 []    90.4  5.9e-25
0047019    3/5     206   290 ..     1   106 []    99.1    4e-29
0051177    3/5     206   286 ..     1    91 []    80.4  2.1e-23
0049427    3/5     209   283 ..     1    87 []    77.6    7e-21
0046451    3/5     214   270 ..     1    62 []    58.7    2e-15
0048887    4/5     280   365 ..     1    87 []    89.9  5.8e-27
0047828    4/5     281   365 ..     1    86 []    89.4  1.4e-23
0051771    4/5     283   365 ..     1    84 []    86.3  1.2e-23
0038590    4/5     286   365 ..     1    72 []    60.6  4.3e-16
0040675    4/5     286   370 ..     1    85 []    86.4  1.5e-23
0049455    4/5     289   366 ..     1    76 []    73.1  9.4e-20
0047715    4/5     290   365 ..     1    76 []    55.9  1.2e-14
0052107    4/5     290   373 ..     1    94 []    77.4  3.7e-21
0047019    4/5     291   377 ..     1   106 []    88.9  5.3e-26
0051177    4/5     292   373 ..     1    91 []    62.4  7.1e-18
0049427    4/5     294   370 ..     1    87 []    73.7  9.5e-20
0046451    4/5     299   357 ..     1    62 []    62.4  1.7e-16
0050575    4/5     303   358 ..    31    87 ..    48.5  4.4e-15
0050575    5/5     359   456 ..     1   119 []    95.3  1.4e-30
0048887    5/5     367   451 ..     1    87 []    96.7    4e-29
0047828    5/5     368   451 ..     1    86 []    95.9    2e-25
0051771    5/5     370   451 ..     1    84 []    92.7  1.6e-25
0038590    5/5     373   451 ..     1    72 []    61.0  3.2e-16
0040675    5/5     373   456 ..     1    85 []    87.1    1e-23
0049455    5/5     376   452 ..     1    76 []    81.8  2.8e-22
0047715    5/5     377   451 ..     1    76 []    49.9  6.4e-13
0052107    5/5     377   459 ..     1    94 []    79.8  7.4e-22
0047019    5/5     378   463 ..     1   106 []    90.7  1.6e-26
0051177    5/5     379   456 ..     1    91 []    60.5  2.6e-17
0049427    5/5     381   456 ..     1    87 []    76.5  1.5e-20
0046451    5/5     386   443 ..     1    62 []    62.7  1.4e-16

Alignments of top-scoring domains:
0050575: domain 1 of 5, from 11 to 130: score 83.9, E = 8.5e-27
                   *->islslkelledsllsl.edlkvGdvvtGtVvsvtdfgvfVdlglggv
                       ++s++ +l +  ++l++++++G+++tG+Vv v + gv Vd+g  ++
  AAS82166.1    11    QTFSMEAALQETEARLeKRVRPGQILTGKVVLVGSEGVAVDIG-AKT 56   

                   eGlvpiselsddl.rvedpeevlkvGdevkvkvlsvdpekgrisLSlkka
                   eG++p+++l+ +    e+++++l++Gdevkv vl+vdpe+g+i+LS+kk+
  AAS82166.1    57 EGIIPFNQLTTKPlSEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKI 106  

                   lleeaweeleealevgeiveGtvvlldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpis
                      l++    l++++++g++++G+Vv + + g+ Vd+g   + eG++p++
  AAS82166.1    19    LQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIG--AKTEGIIPFN 63   

                   elsdkr..vedpedvlkvgdevevkvlevdkekgrivLSlkkldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpise
                      ++   +l++++++g++++G+Vv v + g+ Vd+g   + eG++p+++
  AAS82166.1    20    QETEARLEKRVRPGQILTGKVVLVGSEGVAVDIG--AKTEGIIPFNQ 64   

                   lsddr..vedlsdvlkvgdevevkvlevdkekgrivLSlkkpwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpisels
                         +l++++++g+i++G+Vv v + g+ Vd+g   + eG++p+ +l+
  AAS82166.1    22    TEARLEKRVRPGQILTGKVVLVGSEGVAVDIG--AKTEGIIPFNQLT 66   

                   ddrve..dlsdvlkvgdevevkvlsvdkekgrivLSlkeyeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels.....
                        e ++++g+i+tG+Vv v + gv Vd+g+++eg++p+++l ++   
  AAS82166.1    25    RLEKRVRPGQILTGKVVLVGSEGVAVDIGaKTEGIIPFNQLTtkpls 71   

                   ...pgevlkvgdrvkvkvlevdkerkgivlslkrellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllk
                       l++ +++g++++GkVv + + gv Vd+g   + eg++p+++l+  k
  AAS82166.1    25    RLEKRVRPGQILTGKVVlVGSEGVAVDIG--AKTEGIIPFNQLTT-K 68   

                   r..vedpsell.vGdevkvkvlevdkekgrivLslkklleeeedlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrv..ed
                       ++++g+i++G+Vv v + g+ Vd+g + eG++p+++l+ +++ +e+
  AAS82166.1    28    KRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPLseEE 74   

                   leevlkvgdevkvkvlkvd.ekgrivLslkklkdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli..
                        r g+i+tG+V+ v     ++gv vd+g    ++eg++p+++l ++
  AAS82166.1    29    RVRPGQILTGKVVLV----GSEGVAVDIGA---KTEGIIPFNQLTtk 68   

                   ......pgevlkvgdrvkvyvlevdkeskgpqlslsRkpfkgevveGvVtsvtkfgvfVdlggv.egfvpiselsddrvydfde
                      +++ g++++G+V+ v + gv Vd+g ++eg++p ++l+ ++      
  AAS82166.1    29    RVRPGQILTGKVVLVGSEGVAVDIGAKtEGIIPFNQLTTKPL----- 70   

                   kllllvgedlelvlkvgdevrvkvlevdkeegrivlslkalldelglllkvGevveGtVvsvtdfgafVdlg.gveGlvhiselsddrvlfdeer
                      +++G++++G+Vv v + g+ Vd+g++ eG+++ ++l+ +++      
  AAS82166.1    30    VRPGQILTGKVVLVGSEGVAVDIGaKTEGIIPFNQLTTKPL------ 70   

                   lalvgedpsevlkvGdevevkvlevdlergeldllrivLslkklleeeae
                        e+++++l+ Gdev+v vl+vd+e+g     +i Ls+kk++ +e +
  AAS82166.1    71 ---SEEELRNLLSPGDEVKVQVLRVDPETG-----QILLSRKKIEAQEKW 112  

                   ealeellvgdPfkgevveGtVvsvtkfgvfvdlggv.egfvplselsddrvfdeden
                        +g++++G+Vv v ++gv vd+g ++eg++p+++l+ +        
  AAS82166.1    30    VRPGQILTGKVVLVGSEGVAVDIGAKtEGIIPFNQLTTKPL------ 70   

                   llvw.edlelvlkvgdevrvkvlgvdlekgrivlslklledglGllGdivkGkVvkilpglegafVdiglgvegflpiselslellllelslk
                      G+i++GkVv + +   g+ Vdig ++eg++p+++l++         k
  AAS82166.1    33    GQILTGKVVLVGSE--GVAVDIGAKTEGIIPFNQLTT---------K 68   

                   r..vedisdvlkvGqevlvkvlkvdlgnkgivLslkillegrGtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvg
                      G+V+ v + g+ Vd+g + eG++++++l+ +   l  e+l+++l+ g
  AAS82166.1    38    GKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKP--LSEEELRNLLSPG 82   

                   devevkvlevdkekrlldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpis
                       ++ w+ + e +++g+ v++t+++ +++g++ +l+   g++G++p+s
  AAS82166.1   108    AQEKWDRIQELYEKGEPVTVTIKERVKGGVVAELD---GIQGFMPAS 151  

                   elsdkrvedpedvlkvgdevevkvlevdkekgrivLSlkkldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpise
                      ++ w+++ e +++ge v++t+++ +++g++ +l   +g++G++p+s+
  AAS82166.1   109    QEKWDRIQELYEKGEPVTVTIKERVKGGVVAEL---DGIQGFMPASQ 152  

                   lsddrvedlsdvlkvgdevevkvlevdkekgrivLSlkkpwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpisels
                       w+++ e +++ge v++t+++ +++g++ +l   +g++G++p+s+l+
  AAS82166.1   111    KWDRIQELYEKGEPVTVTIKERVKGGVVAEL---DGIQGFMPASQLD 154  

                   ddrvedlsdvlkvgdevevkvlsvdkekgrivLSlkeyeefklkegeivtGtVvrvtkggvfVdlggvegllplsels....pg
                        ++ +++ge vt t+++ +kggv+ +l+g++g++p+s+l    +p+
  AAS82166.1   114    RIQELYEKGEPVTVTIKERVKGGVVAELDGIQGFMPASQLDlrrvPN 160  

                   evlkvgdrvkvkvlevdkerkgivlslkrellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllk
                       + el+e+g+ v++++++ +++gv+ +l+   g++g++p+s+l+l +
  AAS82166.1   114    RIQELYEKGEPVTVTIKeRVKGGVVAELD---GIQGFMPASQLDL-R 156  

                   rvedpsellvGdevkvkvlevdkekgrivLslkklleeeedlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrvedle
                      e +++ge v++t+++ +++g++ +l+ g++G++p+s+l+ +rv +l+
  AAS82166.1   117    ELYEKGEPVTVTIKERVKGGVVAELD-GIQGFMPASQLDLRRVPNLD 162  

                   evlkvgdevkvkvlkvd.ekgrivLslkklkdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli..
                      ++ +ge vt t+k+      +ggv+ +l+g    ++g++p+s+l   
  AAS82166.1   118    LYEKGEPVTVTIKER----VKGGVVAELDG----IQGFMPASQLDlr 156  

                   ..pgevlkvgdrvkvyvlevdkeskgpqlslsRkpfkgevveGvVtsvtkfgvfVdlggvegfvpiselsddrvydfdek
                       ++kge v++++++ +k+gv+++l+g++gf+p+s+l  +rv      
  AAS82166.1   118    LYEKGEPVTVTIKERVKGGVVAELDGIQGFMPASQLDLRRV------ 158  

                   llllvgedlelvlkvgdevrvkvlevdkeegrivlslkalldelglllkvGevveGtVvsvtdfgafVdlggveGlvhiselsddrvlfdeerl
                      ++ Ge v+ t+++ +++g++ +l+g++G++++s+l+ +rv       
  AAS82166.1   119    YEKGEPVTVTIKERVKGGVVAELDGIQGFMPASQLDLRRV------- 158  

                   alvgedpsevlkvGdevevkvlevdlergeldllrivLslkklleeeaee
                        +++e+  vG+ v +k++e+++++g     r++Ls++++leee ++
  AAS82166.1   159 ----PNLDEF--VGQQVLAKIIEFHRRKG-----RVILSRRAVLEEEQKK 197  

                   aleellvgdPfkgevveGtVvsvtkfgvfvdlggvegfvplselsddrvfdedenl
                        kge v++t+++ +k+gv+++l+g++gf p+s+l+ +rv       
  AAS82166.1   119    YEKGEPVTVTIKERVKGGVVAELDGIQGFMPASQLDLRRV------- 158  

                   lvwedlelvlkvgdevrvkvlgvdlekgrivlslklledglGllGdivkGkVvkilpglegafVdiglgvegflpiselslellllelslk
                      G+ v+ ++++ ++g  g++ +++ g++gf+p+s+l l         +
  AAS82166.1   122    GEPVTVTIKERVKG--GVVAELD-GIQGFMPASQLDL---------R 156  

                   rvedisdvlkvGqevlvkvlkvdlgnkgivLslkillegrGtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvg
                       t+++ +++g++ +l+ g++G+ ++s+l+     +rv +l+++  vg
  AAS82166.1   127    VTIKERVKGGVVAELD-GIQGFMPASQLDL----RRVPNLDEF--VG 166  

                   devevkvlevdkekrdfgvfVdlglggveGlvpiselsddlrvedpeevlkvGdevkvkvls
                      ++gv+ +l+  g++G++p+s+l+ + rv ++ e+  vG+ v +k+++
  AAS82166.1   134    KGGVVAELD--GIQGFMPASQLDLR-RVPNLDEF--VGQQVLAKIIE 175  

                   vdpekgrisLSlkkalleeaweeleealevgeiveGtvvlldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpis
                      + +++e +l+ l++g+vv+GtVv++tdfg+fV+lg    v+Glv++s
  AAS82166.1   195    QKKAREAFLKSLEPGQVVEGTVVEVTDFGVFVNLG---PVDGLVHRS 238  

                   elsdkrvedpedvlkvgdevevkvlevdkekgrivLSlkkldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpise
                       +++e +l+ l++g+vveGtVv+vtdfg+fV+lg    v+Glv++se
  AAS82166.1   196    KKAREAFLKSLEPGQVVEGTVVEVTDFGVFVNLG---PVDGLVHRSE 239  

                   lsddrvedlsdvlkvgdevevkvlevdkekgrivLSlkkpwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpisels
                        e +l+ l++g++v+GtVv+vtdfg+fV+lg    v+Glv++se++
  AAS82166.1   198    AREAFLKSLEPGQVVEGTVVEVTDFGVFVNLG---PVDGLVHRSEIT 241  

                   ddrvedlsdvlkvgdevevkvlsvdkekgrivLSlkeyeefklkegeivtGtVvrvtkggvfVdlggvegllplsels......
                        + +l++g++v+GtVv+vt++gvfV+lg v+gl+++se+     ++
  AAS82166.1   201    AFLKSLEPGQVVEGTVVEVTDFGVFVNLGPVDGLVHRSEITwgrfnh 247  

                   pgevlkvgdrvkvkvlevdkerkgivlslkrellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllk
                       +l+ le+g+vveG+Vv++tdfgvfV+lg    v+glv++se+++ +
  AAS82166.1   201    AFLKSLEPGQVVEGTVVeVTDFGVFVNLG---PVDGLVHRSEITW-G 243  

                   rvedpsell.vGdevkvkvlevdkekgrivLslkklleeeledlkvGdvvtGtVvsvtdfgvfVdlglggveGlvpiselsddlrve
                      l++l++G+vv+GtVv+vtdfgvfV+lg   v+Glv++se++++ r +
  AAS82166.1   203    LKSLEPGQVVEGTVVEVTDFGVFVNLG--PVDGLVHRSEITWG-RFN 246  

                   dpeevlkvGdevkvkvlsvdpekgrisLSlkkalleeaweeleealevge
                   +p+ev+++G++vk+ vlsvdpek+r+ LS+k+++ ++ w +++e+++vg+
  AAS82166.1   247 HPREVIQKGQKVKAQVLSVDPEKERVNLSIKALIPDP-WTTVAEKYPVGT 295  

                   iveGtvvedlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrvedle
                       +l++g++v+GtVv+vtdfg+fV+lg  v+Glv++se++++r+++++
  AAS82166.1   204    KSLEPGQVVEGTVVEVTDFGVFVNLG-PVDGLVHRSEITWGRFNHPR 249  

                   evlkvgdevkvkvlkvd.ekgrivLslkklkdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli..
                      +   g++v+GtV++v    +++gvfv+lg+    v+gl+++se+   
  AAS82166.1   205    SLEPGQVVEGTVVEV----TDFGVFVNLGP----VDGLVHRSEITwg 243  

                   ....pgevlkvgdrvkvyvlevdkeskgpqlslsRkpfkgevveGvVtsvtkfgvfVdlggvegfvpiselsddrvydfdek
                       ++ g+vveG+V++vt+fgvfV+lg+v+g+v++se++++r       
  AAS82166.1   205    SLEPGQVVEGTVVEVTDFGVFVNLGPVDGLVHRSEITWGRF------ 245  

                   llllvgedlelvlkvgdevrvkvlevdkeegrivlslkalldelglllkvGevveGtVvsvtdfgafVdlggveGlvhiselsddrvlfdeerl
                      l++G+vveGtVv+vtdfg+fV+lg v+Glvh+se++++r+       
  AAS82166.1   206    LEPGQVVEGTVVEVTDFGVFVNLGPVDGLVHRSEITWGRF------- 245  

                   alvgedpsevlkvGdevevkvlevdlergeldllrivLslkklleeeaee
                       ++p+ev+++G++v++ vl+vd+e++     r+ Ls+k+l+ +++  
  AAS82166.1   246 ----NHPREVIQKGQKVKAQVLSVDPEKE-----RVNLSIKALIPDPWTT 286  

                   aleellvgdPfkgevveGtVvsvtkfgvfvdlggvegfvplselsddrvfdedenl
                        +g+vveGtVv+vt+fgvfv+lg+v+g+v++se++++r        
  AAS82166.1   206    LEPGQVVEGTVVEVTDFGVFVNLGPVDGLVHRSEITWGRF------- 245  

                   lvwedlelvlkvgdevrvkvlgvdlekgrivlslklledglGllGdivkGkVvkilpglegafVdiglgvegflpiselslellllelslk
                      G++v+G+Vv+++++  g+fV++g  v+g++++se+++         +
  AAS82166.1   209    GQVVEGTVVEVTDF--GVFVNLG-PVDGLVHRSEITW---------G 243  

                   rvedisdvlkvGqevlvkvlkvdlgnkgivLslkillegrGtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvg
                      GtV++vtdfg+fV+lg  v+Glvh+se+++     r++++++v+++g
  AAS82166.1   214    GTVVEVTDFGVFVNLG-PVDGLVHRSEITW----GRFNHPREVIQKG 255  

                   devevkvlevdkekrlldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpis
                      ++dpw ++ e+++vg+ v G+Vv++t fgafV+++  +g+eGl++is
  AAS82166.1   280    IPDPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVE--PGLEGLIHIS 324  

                   elsd.krvedpedvlkvgdevevkvlevdkekgrivLSlkkldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpise
                      +dpw ++ e+++vg+ v G+Vv++t fgafV+++  +g+eGl++ise
  AAS82166.1   281    PDPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVE--PGLEGLIHISE 325  

                   lsd.drvedlsdvlkvgdevevkvlevdkekgrivLSlkkpwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpisels
                      pw +++e+++vg+ v G+Vv++t fgafV+++  +g+eGl++isels
  AAS82166.1   283    PWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVE--PGLEGLIHISELS 327  

                   d.drvedlsdvlkvgdevevkvlsvdkekgrivLSlkeyeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels.....
                         +k+ +g+ v G+Vv++t++g+fV+++ g+egl+++sels ++  
  AAS82166.1   286    TVAEKYPVGTRVRGKVVGLTQFGAFVEVEpGLEGLIHISELSwtkrp 332  

                   ..pgevlkvgdrvkvkvlevdkerkgivlslkrellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllk
                      +++e+++vg+ v GkVv +t+fg+fV+++  +g+egl++isels++k
  AAS82166.1   286    TVAEKYPVGTRVRGKVVgLTQFGAFVEVE--PGLEGLIHISELSWTK 330  

                   rvedpsell.vGdevkvkvlevdkekgrivLslkklleeeedlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsd.drvedl
                      e++ vg+ v G+Vv++t fgafV++++g+eGl++isels+++r +++
  AAS82166.1   289    EKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWtKRPKHP 335  

                   eevlkvgdevkvkvlkvd.ekgrivLslkklkdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli..
                      k+++g+ v G+V+ +    +++g+fv++++   g+egl+++sel+ +
  AAS82166.1   290    KYPVGTRVRGKVVGL----TQFGAFVEVEP---GLEGLIHISELSwt 329  

                   .....pgevlkvgdrvkvyvlevdkeskgpqlslsRkpfkgevveGvVtsvtkfgvfVdl.ggvegfvpiselsddrvydfde
                      k+ +g+ v G+V+++t fg+fV++++g+eg+++isels+ +      
  AAS82166.1   290    KYPVGTRVRGKVVGLTQFGAFVEVePGLEGLIHISELSWTKR----- 331  

                   kllllvgedlelvlkvgdevrvkvlevdkeegrivlslkalldelglllkvGevveGtVvsvtdfgafVdl.ggveGlvhiselsd.drvlfdee
                      + vG  v G+Vv++t fgafV++++g+eGl+hisels+++r      
  AAS82166.1   291    YPVGTRVRGKVVGLTQFGAFVEVePGLEGLIHISELSWtKRP----- 332  

                   rlalvgedpsevlkvGdevevkvlevdlergeldllrivLslkklleeea
                         ++psev+k+Gdeve++vl++d+e++     r++L+lk+++ +++
  AAS82166.1   333 ------KHPSEVVKEGDEVEAVVLRLDPEER-----RLSLGLKQTQPDPW 371  

                   eealeellvgdPfkgevveGtVvsvtkfgvfvdlg.gvegfvplselsddrvfdeden
                      P +g  v G+Vv++t+fg+fv+++ g+eg++++sels+ ++      
  AAS82166.1   292    P-VGTRVRGKVVGLTQFGAFVEVEpGLEGLIHISELSWTKR------ 331  

                   llvwedlelvlkvgdevrvkvlgvdlekgrivlslklledglGllGdivkGkVvkilpglegafVdiglgvegflpiselslellllelslk
                      G+ v+GkVv+++++  gafV++++g+eg+++isels++        k
  AAS82166.1   294    GTRVRGKVVGLTQF--GAFVEVEPGLEGLIHISELSWT--------K 330  

                   rvedisdvlkvGqevlvkvlkvdlgnkgivLslkillegrGtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvg
                      G+V+++t+fgafV++++g+eGl+hisels++   +r +++s+v+k+g
  AAS82166.1   299    GKVVGLTQFGAFVEVEPGLEGLIHISELSWT---KRPKHPSEVVKEG 342  

                   devevkvlevdkekrsvtdfgvfVdlglggveGlvpiselsddlrvedpeevlkvGdevkvk
                      ++t fg+fV+++ +g+eGl++isels+++r ++p+ev+k+Gdev+++
  AAS82166.1   303    GLTQFGAFVEVE-PGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAV 348  

                   vlsvdpekgrislslkelledsllsl.edlkvGdvvtGtVvsvtdfgvfVdlglggv
                      +sl+lk+   d++ +l+e++++G+v++G+V++vtdfgvfV+++ +g+
  AAS82166.1   359    LSLGLKQTQPDPWQQLtEKYPPGTVLKGKVTGVTDFGVFVEIE-PGI 404  

                   eGlvpiselsddlrvedpeevlkvGdevkvkvlsvdpekgrisLSlkkal
                   eGlv++sel+++ rve+p  ++k+Gde++v+vl++dp ++r+sLS+k++l
  AAS82166.1   405 EGLVHVSELDHK-RVENPAALFKKGDEMEVVVLNIDPVEQRVSLSRKRLL 453  

                   leeaweeleealevgeiveGtvvlldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpis
                      ++dpw++l+e++++g+v+kG+V+++tdfg+fV+++  +g+eGlv++s
  AAS82166.1   367    QPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIE--PGIEGLVHVS 411  

                   elsdkrvedpedvlkvgdevevkvlevdkekgrivLSlkkldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpise
                      +dpw++l e++++g+v++G+V++vtdfg+fV+++  +g+eGlv++se
  AAS82166.1   368    PDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIE--PGIEGLVHVSE 412  

                   lsddrvedlsdvlkvgdevevkvlevdkekgrivLSlkkpwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpisels
                      pw++l e++++g+++kG+V++vtdfg+fV+++  +g+eGlv++sel+
  AAS82166.1   370    PWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIE--PGIEGLVHVSELD 414  

                   ddrvedlsdvlkvgdevevkvlsvdkekgrivLSlkeyeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels.....
                         +k+ +g++++G+V++vt++gvfV+++ g+egl+++sel ++ ++
  AAS82166.1   373    QLTEKYPPGTVLKGKVTGVTDFGVFVEIEpGIEGLVHVSELDhkrve 419  

                   .pgevlkvgdrvkvkvlevdkerkgivlslkrellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllk
                       l e++++g+v++GkV+ +tdfgvfV+++  +g+eglv++sel++ k
  AAS82166.1   373    QLTEKYPPGTVLKGKVTgVTDFGVFVEIE--PGIEGLVHVSELDH-K 416  

                   rvedpsell.vGdevkvkvlevdkekgrivLslkklleeeedlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrvedle
                      e++ +g+++kG+V++vtdfg+fV++++g+eGlv++sel+++rve++ 
  AAS82166.1   376    EKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVENPA 422  

                   evlkvgdevkvkvlkvd.ekgrivLslkklkdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli..
                      k++ g++++G+V+ v    +++gvfv++++   g+egl++vsel ++
  AAS82166.1   377    KYPPGTVLKGKVTGV----TDFGVFVEIEP---GIEGLVHVSELDhk 416  

                   ....pgevlkvgdrvkvyvlevdkeskgpqlslsRkpfkgevveGvVtsvtkfgvfVdl.ggvegfvpiselsddrvydfde
                      k+  g+v++G+Vt+vt+fgvfV++++g+eg+v++sel ++rv     
  AAS82166.1   377    KYPPGTVLKGKVTGVTDFGVFVEIePGIEGLVHVSELDHKRV----- 418  

                   kllllvgedlelvlkvgdevrvkvlevdkeegrivlslkalldelglllkvGevveGtVvsvtdfgafVdl.ggveGlvhiselsddrvlfdeer
                      + +G v++G+V++vtdfg+fV++++g+eGlvh+sel+++rv      
  AAS82166.1   378    YPPGTVLKGKVTGVTDFGVFVEIePGIEGLVHVSELDHKRV------ 418  

                   lalvgedpsevlkvGdevevkvlevdlergeldllrivLslkklleeeae
                        e+p  ++k+Gde+ev+vl++d+ ++     r++Ls+k+ll  ++ 
  AAS82166.1   419 -----ENPAALFKKGDEMEVVVLNIDPVEQ-----RVSLSRKRLLPPPLP 458  

                   ealeellvgdPfkgevveGtVvsvtkfgvfvdlg.gvegfvplselsddrvfdeden
                      P +g v++G+V++vt+fgvfv+++ g+eg+v++sel+++rv      
  AAS82166.1   379    P-PGTVLKGKVTGVTDFGVFVEIEpGIEGLVHVSELDHKRV------ 418  

                   llvwedlelvlkvgdevrvkvlgvdlekgrivlslklledglGllGdivkGkVvkilpglegafVdiglgvegflpiselslellllelslk
                      G+++kGkV++++++  g+fV+i++g+eg++++sel +         k
  AAS82166.1   381    GTVLKGKVTGVTDF--GVFVEIEPGIEGLVHVSELDH---------K 416  

                   rvedisdvlkvGqevlvkvlkvdlgnkgivLslkillegrGtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvg
                      G+Vt+vtdfg+fV++++g+eGlvh+sel++    +rve++  ++k+g
  AAS82166.1   386    GKVTGVTDFGVFVEIEPGIEGLVHVSELDH----KRVENPAALFKKG 428  

                   devevkvlevdkekr