RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAS81585.1 tthe0 AAS81585.1 GIB00176CH01 "probable thymidylate
kinase"
         (198 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1e2mA [c.37.1] THYMIDINE KINASE                                        67   3e-14
2a2zB [x.x.x] DEOXYCYTIDINE KINASE                                     63   6e-13
2a2zA [x.x.x] DEOXYCYTIDINE KINASE                                     61   3e-12
2c95B [x.x.x] ADENYLATE KINASE 1                                       59   1e-11
1akyA [x.x.x] ADENYLATE KINASE                                         59   2e-11
2cdnA [x.x.x] ADENYLATE KINASE                                         59   2e-11
1e2kA [c.37.1] THYMIDINE KINASE                                        56   1e-10
1e2iA [c.37.1] THYMIDINE KINASE                                        56   1e-10
2a2zD [x.x.x] DEOXYCYTIDINE KINASE                                     53   9e-10
1e2hA [c.37.1] THYMIDINE KINASE                                        50   8e-09
2bwjC [x.x.x] ADENYLATE KINASE 5                                       49   1e-08
2a30B [x.x.x] DEOXYCYTIDINE KINASE                                     49   1e-08
2ccgB [x.x.x] THYMIDYLATE KINASE                                       49   1e-08
1e2fA [c.37.1] THYMIDYLATE KINASE                                      48   2e-08
1e2lA [c.37.1] THYMIDINE KINASE                                        48   3e-08
3akyA [x.x.x] ADENYLATE KINASE                                         47   4e-08
1e2jA [c.37.1] THYMIDINE KINASE                                        47   5e-08
1e2nA [c.37.1] THYMIDINE KINASE                                        45   2e-07
2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     45   2e-07
3adkA [x.x.x] ADENYLATE KINASE                                         44   3e-07
2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     44   3e-07
3czpB [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2                          40   4e-06
1e9dA [c.37.1] THYMIDYLATE KINASE                                      40   4e-06
1e2lB [c.37.1] THYMIDINE KINASE                                        40   4e-06
2bwjE [x.x.x] ADENYLATE KINASE 5                                       40   5e-06
1e2kB [c.37.1] THYMIDINE KINASE                                        39   9e-06
2a30A [x.x.x] DEOXYCYTIDINE KINASE                                     39   1e-05
1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE                               39   2e-05
1e2mB [c.37.1] THYMIDINE KINASE                                        38   2e-05
3blvH [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2                 37   4e-05
2bwjD [x.x.x] ADENYLATE KINASE 5                                       37   5e-05
2bwjF [x.x.x] ADENYLATE KINASE 5                                       36   8e-05
1e2jB [c.37.1] THYMIDINE KINASE                                        36   1e-04
3do6A [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE                         35   2e-04
2dwoA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                   34   4e-04
3c95A [x.x.x] EXODEOXYRIBONUCLEASE I                                   33   6e-04
1e9cA [c.37.1] THYMIDYLATE KINASE                                      33   6e-04
1e2iB [c.37.1] THYMIDINE KINASE                                        33   7e-04
2cckA [x.x.x] THYMIDYLATE KINASE                                       33   7e-04

>1e2mA [c.37.1] THYMIDINE KINASE
          Length = 305

 Score = 67.4 bits (163), Expect = 3e-14
 Identities = 33/221 (14%), Positives = 55/221 (24%), Gaps = 26/221 (11%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQE------ 55
             L + ++G  G GKTT  + L   +     P+   R  G                    
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI 62

Query: 56  ---------LSPEAEYLLFSADRAEHVRKVILPGLAAG--KVVISDRYLDSSLAYQGY-- 102
                     S +    +  A     +   I     +     +I DR+  ++L       
Sbjct: 63  SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAAR 122

Query: 103 --GRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRV-RRPDRLEGLGLEFFRRVR 159
                +    +          L      L  LP +  + R+ +R    E L L     +R
Sbjct: 123 YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIR 182

Query: 160 EGYLALARA----EPGRFVVLDATLPEEEIARAIQAHLRPL 196
             Y  LA      + G     D                   
Sbjct: 183 RVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLFTLF 223


>2a2zB [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 63.2 bits (152), Expect = 6e-13
 Identities = 31/217 (14%), Positives = 64/217 (29%), Gaps = 22/217 (10%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQ-----ELS 57
              +++EG   +GK+T    L    E                      ++ +       +
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 58  PEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLP-----WLR 112
            +    L              P L   + V SDRY+ +S  Y+              W  
Sbjct: 62  FQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHD 121

Query: 113 EVAREATRGLKPRLTFLLDLPPEAALRRVRRPDR--LEGLGLEFFRRVREGY-------- 162
            +  +  + L+      L   PE  L R+    R   +G+ LE+  ++   +        
Sbjct: 122 WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT 181

Query: 163 --LALARAEPGRFVVLDATLPEEEIARAIQAHLRPLL 197
                   +    + LD     ++   ++   ++  L
Sbjct: 182 LKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL 218


>2a2zA [x.x.x] DEOXYCYTIDINE KINASE
          Length = 222

 Score = 61.2 bits (147), Expect = 3e-12
 Identities = 30/218 (13%), Positives = 62/218 (28%), Gaps = 23/218 (10%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQE------L 56
              +++EG   +GK+T    L    E                      ++ ++       
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 57  SPEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQG-----YGRGLPLPWL 111
                 L     +   +     P L   + V SDRY+ +S  Y+          +   W 
Sbjct: 62  FQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH 121

Query: 112 REVAREATRGLKPRLTFLLDLPPEAALRRVRR----------PDRLEGLGLEFFRRVREG 161
             +  +  + L+      L   PE  L R+             + LE L  +    +   
Sbjct: 122 DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHR 181

Query: 162 --YLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLL 197
                    +    + LD     ++   ++   ++  L
Sbjct: 182 TLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL 219


>2c95B [x.x.x] ADENYLATE KINASE 1
          Length = 194

 Score = 58.9 bits (141), Expect = 1e-11
 Identities = 29/207 (14%), Positives = 57/207 (27%), Gaps = 28/207 (13%)

Query: 1   MPGLFLTLEGLDGSGKTTQARRLAAFLEAQ----GRPVLLTREPGGGLPEVRSLLLTQEL 56
                + + G  GSGK TQ  ++           G  +      G    +          
Sbjct: 5   KKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKL------SE 58

Query: 57  SPEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAR 116
             E   L+      + +R  ++  +   K  + D Y       + + R +  P       
Sbjct: 59  IMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPT------ 112

Query: 117 EATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARA------EP 170
                L   +    +   +  L+R            E  ++  E Y            + 
Sbjct: 113 -----LLLYVDAGPETMTQRLLKR-GETSGRVDDNEETIKKRLETYYKATEPVIAFYEKR 166

Query: 171 GRFVVLDATLPEEEIARAIQAHLRPLL 197
           G    ++A    + +   +  HL  LL
Sbjct: 167 GIVRKVNAEGSVDSVFSQVCTHLDALL 193


>1akyA [x.x.x] ADENYLATE KINASE
          Length = 218

 Score = 58.6 bits (140), Expect = 2e-11
 Identities = 29/227 (12%), Positives = 56/227 (24%), Gaps = 49/227 (21%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEY 62
            + + L G  G+GK TQA  L     A                    L    +   +   
Sbjct: 2   SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEA--KKIMDQGG 59

Query: 63  LLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGL 122
           L+        ++  +    A     I D +  +    +   + L             +G 
Sbjct: 60  LVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLK-----------EQGT 108

Query: 123 KPRLTFLLDLPPEAALRRVRR----------------PDRLEGLG--------------L 152
                  L +  E  + R+                  P + +                  
Sbjct: 109 PLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNA 168

Query: 153 EFFRRVREGYLALARA------EPGRFVVLDATLPEEEIARAIQAHL 193
           +  ++    Y A          + G +  +DA+ P   +   I   L
Sbjct: 169 DALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKL 215


>2cdnA [x.x.x] ADENYLATE KINASE
          Length = 186

 Score = 58.6 bits (140), Expect = 2e-11
 Identities = 33/195 (16%), Positives = 54/195 (27%), Gaps = 17/195 (8%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEY 62
            + + L G  G+GK TQA +LA  L                      L +  +   +A  
Sbjct: 5   HMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGT--KLGVEAKRYLDAGD 62

Query: 63  LLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGL 122
           L+ S    E V   +    AA   ++                               RG 
Sbjct: 63  LVPSDLTNELVDDRLNNPDAANGFILDGYPRSVE------------QAKALHEMLERRGT 110

Query: 123 KPRLTFLLDLPPEAALRRV---RRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDAT 179
                    +  E  L R+    R D  + + L   +  R+    L      +   +DA 
Sbjct: 111 DIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAV 170

Query: 180 LPEEEIARAIQAHLR 194
              +E+       L 
Sbjct: 171 GTMDEVFARALRALG 185


>1e2kA [c.37.1] THYMIDINE KINASE
          Length = 308

 Score = 55.9 bits (133), Expect = 1e-10
 Identities = 34/226 (15%), Positives = 56/226 (24%), Gaps = 34/226 (15%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRS------------ 49
             L + ++G  G GKTT  + L A         +      G    + +            
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGE 62

Query: 50  LLLTQELSPEAEYLLFSADRAEHVRKVILPGLAAG------KVVISDRYLDSSLAYQGYG 103
           +             +           V+ P +           +I DR+  ++L      
Sbjct: 63  ISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCY-PA 121

Query: 104 RGLPLPWLREVAREATRGLKPRL------TFLLDLPPEAALRRVRRPDRLEGLGLEFFRR 157
               +  +   A  A   L P                    R  +R    E L L     
Sbjct: 122 ARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA 181

Query: 158 VREGYLALA---------RAEPGRFVVLDATLPEEEIARAIQAHLR 194
           +R  Y  LA          +    +  L  T P   I   +    R
Sbjct: 182 IRRVYGLLANTVRYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFR 227


>1e2iA [c.37.1] THYMIDINE KINASE
          Length = 300

 Score = 55.9 bits (133), Expect = 1e-10
 Identities = 30/217 (13%), Positives = 53/217 (24%), Gaps = 24/217 (11%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQEL----S 57
             L + ++G  G GKT     +   +                  + R             
Sbjct: 3   TLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAV 62

Query: 58  PEAEYLLFSADRAEHVRKVILPG------LAAGKVVISDRYLDSSLAY----QGYGRGLP 107
                 +           V+ P             +I DR+  ++L      +     + 
Sbjct: 63  VMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMT 122

Query: 108 LPWLREVAREATRGLKPRLTFLLDLPPEAALRRV-RRPDRLEGLGLEFFRRVREGY---- 162
              +          L      L  LP +  + R+ +R    E L L     +R  Y    
Sbjct: 123 PQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLA 182

Query: 163 -----LALARAEPGRFVVLDATLPEEEIARAIQAHLR 194
                L    +    +  L  T P   I   +    R
Sbjct: 183 NTVRYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFR 219


>2a2zD [x.x.x] DEOXYCYTIDINE KINASE
          Length = 220

 Score = 52.7 bits (125), Expect = 9e-10
 Identities = 34/216 (15%), Positives = 66/216 (30%), Gaps = 21/216 (9%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLT----QELSP 58
              +++EG   +GK+T    L    E                      ++     +    
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 59  EAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLP-----WLRE 113
              Y   S  RA+       P L   + V SDRY+ +S  Y+              W   
Sbjct: 62  FQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDW 121

Query: 114 VAREATRGLKPRLTFLLDLPPEAALRRVRRPDR--LEGLGLEFFRRVREGY--------- 162
           +  +  + L+      L   PE  L R+    R   +G+ LE+  ++   +         
Sbjct: 122 MNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL 181

Query: 163 -LALARAEPGRFVVLDATLPEEEIARAIQAHLRPLL 197
                  +    + LD     ++   ++   ++  L
Sbjct: 182 KTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL 217


>1e2hA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 49.5 bits (116), Expect = 8e-09
 Identities = 30/190 (15%), Positives = 50/190 (26%), Gaps = 23/190 (12%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQE------ 55
             L + ++G  G GKTT  + L   +     P+   R  G                    
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI 62

Query: 56  -----LSPEAEYLLFSADRAEHVRKVILPGLAA-------GKVVISDRYLDSSLAYQ--- 100
                        +           V+ P +            +I DR+  ++L      
Sbjct: 63  SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAA 122

Query: 101 -GYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRV-RRPDRLEGLGLEFFRRV 158
                 +    +          L      L  LP +  + R+ +R    E L L     +
Sbjct: 123 RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAI 182

Query: 159 REGYLALARA 168
           R  Y  LA  
Sbjct: 183 RRVYGLLANT 192


>2bwjC [x.x.x] ADENYLATE KINASE 5
          Length = 193

 Score = 49.0 bits (115), Expect = 1e-08
 Identities = 32/203 (15%), Positives = 61/203 (30%), Gaps = 20/203 (9%)

Query: 1   MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPV-LLTREPGGGLPEVRSLLLTQELSPE 59
                + + G  GSGK TQ  +L             L RE      E RS L       E
Sbjct: 5   RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE-RSKL--IRDIME 61

Query: 60  AEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREAT 119
              L+ S    E +++ ++  L   +  + D Y       + +GR +  P          
Sbjct: 62  RGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQ--------- 112

Query: 120 RGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVRE-----GYLALARAEPGRFV 174
             L   +    D      L+  R    ++       +R+         +        +  
Sbjct: 113 --LVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLH 170

Query: 175 VLDATLPEEEIARAIQAHLRPLL 197
            ++A    E++   +   +  + 
Sbjct: 171 KINAEGTPEDVFLQLCTAIDSIF 193


>2a30B [x.x.x] DEOXYCYTIDINE KINASE
          Length = 212

 Score = 48.9 bits (115), Expect = 1e-08
 Identities = 30/207 (14%), Positives = 59/207 (28%), Gaps = 18/207 (8%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQ-GRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
              +++EG   +GK+T    L   +  +        +                       
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYA 61

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLP-----WLREVAR 116
            L     +   +     P L   + V SDRY+ +S  Y+              W   +  
Sbjct: 62  CLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNN 121

Query: 117 EATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGL--EFFRRVREGY----------LA 164
           +  + L+      L   PE  L R+    R E  G+  E+  ++   +            
Sbjct: 122 QFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTN 181

Query: 165 LARAEPGRFVVLDATLPEEEIARAIQA 191
               +    + LD    E  + +  + 
Sbjct: 182 FDYLQEVPILTLDVNEYESLVEKVKEF 208


>2ccgB [x.x.x] THYMIDYLATE KINASE
          Length = 199

 Score = 48.7 bits (115), Expect = 1e-08
 Identities = 63/197 (31%), Positives = 93/197 (47%), Gaps = 3/197 (1%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLP--EVRSLLLTQELSPEA 60
             F+T EG +GSGKTT    +   L      ++     G        + +L   ++    
Sbjct: 2   SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRT 61

Query: 61  EYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATR 120
           E +LF+A R EH+   ++P L  GKVV+ DRY+DSSLAYQGY RG+ +  +R +   A  
Sbjct: 62  EAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAIN 121

Query: 121 GLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATL 180
           GL P LT  L+       R     + L+   L+F  +V EGY  +   E  RF  ++A  
Sbjct: 122 GLYPDLTIYLN-VSAEVGRERIIKNSLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQ 180

Query: 181 PEEEIARAIQAHLRPLL 197
           P E +       +   L
Sbjct: 181 PLENVVEDTYQTIIKYL 197


>1e2fA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 48.0 bits (113), Expect = 2e-08
 Identities = 36/197 (18%), Positives = 62/197 (31%), Gaps = 3/197 (1%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLT-QELSPEA 60
            G  + LEG+D +GK+TQ+R+L   L A G    L R P       + L    Q+ S   
Sbjct: 3   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 62

Query: 61  EYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATR 120
           ++ +     A    +V L      + V       +       G             +   
Sbjct: 63  DHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGL 122

Query: 121 GLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATL 180
                +   L L    A +R             F  R    +  L +     + ++DA+ 
Sbjct: 123 PKPDLV-LFLQLQLADAAKRGAF-GHERYENGAFQERALRCFHQLMKDTTLNWKMVDASK 180

Query: 181 PEEEIARAIQAHLRPLL 197
             E +   I+      +
Sbjct: 181 SIEAVHEDIRVLSEDAI 197


>1e2lA [c.37.1] THYMIDINE KINASE
          Length = 304

 Score = 47.5 bits (111), Expect = 3e-08
 Identities = 29/187 (15%), Positives = 50/187 (26%), Gaps = 21/187 (11%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQE------- 55
            L + ++G  G GKTT  + L      +             +  + +     +       
Sbjct: 4   LLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISAG 63

Query: 56  --LSPEAEYLLFSADRAEHVRKVILPGLAAGK-------VVISDRYLDSSLAYQGYGRGL 106
                     +           V+ P +            +I DR+  ++L      R L
Sbjct: 64  DAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYL 123

Query: 107 ----PLPWLREVAREATRGLKPRLTFLLDLPPEAALRR-VRRPDRLEGLGLEFFRRVREG 161
                   +          L      L  LP +  + R  +R    E L L     +R  
Sbjct: 124 MGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRV 183

Query: 162 YLALARA 168
           Y  LA  
Sbjct: 184 YGLLANT 190


>3akyA [x.x.x] ADENYLATE KINASE
          Length = 218

 Score = 47.3 bits (111), Expect = 4e-08
 Identities = 28/227 (12%), Positives = 53/227 (23%), Gaps = 49/227 (21%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEY 62
            + + L G  G+GK TQA  L     A                    L   +    +   
Sbjct: 2   SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKI--MDQGG 59

Query: 63  LLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGL 122
           L+        ++  +    A     I D +  +    +   + L             +G 
Sbjct: 60  LVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQML-----------KEQGT 108

Query: 123 KPRLTFLLDLPPEAALRRVRRPDRLEGLG------------------------------L 152
                  L +  E  + R+         G                               
Sbjct: 109 PLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNA 168

Query: 153 EFFRRVREGYLALARA------EPGRFVVLDATLPEEEIARAIQAHL 193
           +  ++    Y A          + G +  +DA+ P   +       L
Sbjct: 169 DALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKL 215


>1e2jA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 46.8 bits (109), Expect = 5e-08
 Identities = 30/190 (15%), Positives = 50/190 (26%), Gaps = 23/190 (12%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQ------- 54
             L + ++G  G GKTT  + L   +     P+   R  G                    
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI 62

Query: 55  ----ELSPEAEYLLFSADRAEHVRKVILPGLAA-------GKVVISDRYLDSSLAYQGY- 102
                        +           V+ P +            +I DR+  ++L      
Sbjct: 63  SAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAA 122

Query: 103 ---GRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRV-RRPDRLEGLGLEFFRRV 158
                 +    +          L      L  LP +  + R+ +R    E L L     +
Sbjct: 123 RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAI 182

Query: 159 REGYLALARA 168
           R  Y  LA  
Sbjct: 183 RRVYGLLANT 192


>1e2nA [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 44.7 bits (104), Expect = 2e-07
 Identities = 33/195 (16%), Positives = 53/195 (27%), Gaps = 27/195 (13%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPV----LLTREPGGGLPEVRSLLLTQELS 57
             L + ++G  G GKTT  + L A             +      G    + ++  TQ   
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL 62

Query: 58  P----------------EAEYLLFSADRAEHVRKVILPGL--AAGKVVISDRYLDSSLAY 99
                            +    +  A     +   I           +I DR+  ++L  
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC 122

Query: 100 QGYGRGLP----LPWLREVAREATRGLKPRLTFLLDLPPEAALRR-VRRPDRLEGLGLEF 154
               R L        +          L      L  LP +  + R  +R    E L L  
Sbjct: 123 YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAM 182

Query: 155 FRRVREGYLALARAE 169
              +R  Y  LA   
Sbjct: 183 LAAIRRVYGLLANTV 197


>2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 195

 Score = 44.6 bits (104), Expect = 2e-07
 Identities = 27/196 (13%), Positives = 48/196 (24%), Gaps = 28/196 (14%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
            G  + L GL G+GKTT +  L  +L +   P                      +     
Sbjct: 18  RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLD--------------GDNVRHGLN 63

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRG 121
             L  +          +  +A        +    +          P    RE AR+    
Sbjct: 64  RNLGFSPGDREENIRRIAEVA--------KLFADAGLVCITSFISPFAKDRENARKIHES 115

Query: 122 LKPRLT-FLLDLPPEAALRRVRRPDRLEGL--GLEFFRRVREGYLALARAEPGRFVVLDA 178
                    +D P      R  +          ++ F  +   Y      E    V+   
Sbjct: 116 AGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPE---RVLKTN 172

Query: 179 TLPEEEIARAIQAHLR 194
                +    +   L+
Sbjct: 173 LSTVSDCVHQVVELLQ 188


>3adkA [x.x.x] ADENYLATE KINASE
          Length = 194

 Score = 44.2 bits (103), Expect = 3e-07
 Identities = 26/199 (13%), Positives = 51/199 (25%), Gaps = 20/199 (10%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
               + + G  GSGK TQ  ++                        R          E  
Sbjct: 7   KSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSAR--GKMLSEIMEKG 64

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRG 121
            L+      + +R  ++  +   K  + D Y       + + R +  P L          
Sbjct: 65  QLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPE- 123

Query: 122 LKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALAR------AEPGRFVV 175
                        +  L+R            E  ++  E Y            + G    
Sbjct: 124 ----------TMTKRLLKR-GETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRK 172

Query: 176 LDATLPEEEIARAIQAHLR 194
           ++A    +++   +  HL 
Sbjct: 173 VNAEGSVDDVFSQVCTHLD 191


>2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 198

 Score = 44.2 bits (103), Expect = 3e-07
 Identities = 32/196 (16%), Positives = 53/196 (27%), Gaps = 28/196 (14%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
            G  + L GL G+GKTT +  L  +L +   P              R+L  +        
Sbjct: 21  RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPG------ 74

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRG 121
                 +    + +V      AG V I+                 P    RE AR+    
Sbjct: 75  ---DREENIRRIAEVAKLFADAGLVCITS-------------FISPFAKDRENARKIHES 118

Query: 122 LKPRLT-FLLDLPPEAALRRVRRPDRLEGL--GLEFFRRVREGYLALARAEPGRFVVLDA 178
                    +D P      R  +          ++ F  +   Y      E    V+   
Sbjct: 119 AGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPE---RVLKTN 175

Query: 179 TLPEEEIARAIQAHLR 194
                +    +   L+
Sbjct: 176 LSTVSDCVHQVVELLQ 191


>3czpB [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
          Length = 452

 Score = 40.4 bits (93), Expect = 4e-06
 Identities = 10/39 (25%), Positives = 16/39 (41%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREP 40
             L    EG D +GK    RR+   L+ +   ++    P
Sbjct: 255 HSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAP 293



 Score = 38.9 bits (89), Expect = 1e-05
 Identities = 5/34 (14%), Positives = 13/34 (38%)

Query: 2  PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVL 35
            + + + G++G+GK    + L  +         
Sbjct: 39 FPVIILINGIEGAGKGETVKLLNEWDPRLIEVQS 72


>1e9dA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 40.4 bits (93), Expect = 4e-06
 Identities = 35/196 (17%), Positives = 63/196 (32%), Gaps = 1/196 (0%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
            G  + LEG+D +GK+TQ+R+L   L A G    L R P       + L    +   + E
Sbjct: 3   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 62

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRG 121
                   + +  + +          ++      + +   Y        L    +     
Sbjct: 63  DHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGL 122

Query: 122 LKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLP 181
            KP L   L L    A +R             F  R    +  L +     + ++DA+  
Sbjct: 123 PKPDLVLFLQLQLADAAKRGAFGHERYE-NGAFQERALRCFHQLMKDTTLNWKMVDASKS 181

Query: 182 EEEIARAIQAHLRPLL 197
            E +   I+      +
Sbjct: 182 IEAVHEDIRVLSEDAI 197


>1e2lB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 40.4 bits (93), Expect = 4e-06
 Identities = 29/193 (15%), Positives = 50/193 (25%), Gaps = 31/193 (16%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQ-----GRPVLLTREPGGGLP----------- 45
             L + ++G  G GKTT  + L A            P+   R  G               
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIFTTQHRL 62

Query: 46  EVRSLLLTQELSPEAEYLLFSADRAEHVRKVILPGLAAG------KVVISDRYLDSSLAY 99
           +   +             +           V+ P +           +I DR+  ++L  
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC 122

Query: 100 Q----GYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFF 155
                     +    +          L      L  LP +  + R+ +      L L   
Sbjct: 123 YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAK-----RLDLAML 177

Query: 156 RRVREGYLALARA 168
             +R  Y  LA  
Sbjct: 178 AAIRRVYGLLANT 190


>2bwjE [x.x.x] ADENYLATE KINASE 5
          Length = 190

 Score = 40.4 bits (93), Expect = 5e-06
 Identities = 29/205 (14%), Positives = 54/205 (26%), Gaps = 24/205 (11%)

Query: 1   MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEA 60
                + + G  GSGK TQ  +L                           LL +EL+ E+
Sbjct: 2   RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------GELLREELASES 47

Query: 61  EYLL---FSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVARE 117
           E         +R + V   I+  L      +     D+                    R 
Sbjct: 48  ERSKLIRDIMERGDLVPSGIVLELLKE--AMVASLGDTRGFLIDGYPREVKQGEEFGRRI 105

Query: 118 ATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALAR-----AEPGR 172
               L   +    D      L+  R    ++       +R+   Y A            +
Sbjct: 106 GDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQ 165

Query: 173 FVVLDATLPEEEIARAIQAHLRPLL 197
              ++A    E++   +   +  + 
Sbjct: 166 LHKINAEGTPEDVFLQLCTAIDSIF 190


>1e2kB [c.37.1] THYMIDINE KINASE
          Length = 316

 Score = 39.4 bits (90), Expect = 9e-06
 Identities = 26/222 (11%), Positives = 51/222 (22%), Gaps = 41/222 (18%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLL---------- 51
             L + ++G  G GKTT  + L A         +        +      +          
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL 62

Query: 52  ------LTQELSPEAEYLLFSADRAEHVRKVILPGLAA-------GKVVISDRYLDSSLA 98
                             +           V+ P +            +I DR+  ++L 
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAALL 122

Query: 99  YQGYGRGLPLPWLREVARE----ATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLE- 153
                R L      +            L      L  LP +  + R+ + +RL+   L  
Sbjct: 123 CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAMLAA 182

Query: 154 -------------FFRRVREGYLALARAEPGRFVVLDATLPE 182
                        + +          +         +A    
Sbjct: 183 IRRVYGLLANTVRYLQCGGSWREDWGQLSGTAVPQSNAGPRP 224


>2a30A [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 39.0 bits (89), Expect = 1e-05
 Identities = 33/221 (14%), Positives = 64/221 (28%), Gaps = 28/221 (12%)

Query: 3   GLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLL----------L 52
              +++EG   +GK+T    L    E                      +           
Sbjct: 2   IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT 61

Query: 53  TQELSPEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLP--- 109
            Q  +  +      A     ++    P L   + V SDRY+ +S  Y+            
Sbjct: 62  FQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIY 121

Query: 110 --WLREVAREATRGLKPRLTFLLDLPPEAALR--RVRRPDRLEGLGLEFFRRVREGY--- 162
             W   +  +  + L+      L   PE  L    +R  +  +G+ LE+  ++   +   
Sbjct: 122 QDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESW 181

Query: 163 -------LALARAEPGRFVVLDATLPEEEIARAIQAHLRPL 196
                        +    + LD     E +   ++  L  L
Sbjct: 182 LLHRTLKTNFDYLQEVPILTLDVNEY-ESLVEKVKEFLSTL 221


>1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 220

 Score = 38.6 bits (88), Expect = 2e-05
 Identities = 31/217 (14%), Positives = 54/217 (24%), Gaps = 27/217 (12%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
             + + L G  G+GK TQA  L     A                      L  +   +  
Sbjct: 3   ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQL--GLEAKKIMDQG 60

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVVISD-----RYLDSSLAYQGYGRGLPLPWL----- 111
            L+        ++  +    A     I             L      +G PL        
Sbjct: 61  GLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKV 120

Query: 112 -REVAREATRGLKPR------LTFLLDLPPEAALRRV--RRPDRLEGLGLEFFRRVREGY 162
             E+      G             + + P E     V      ++     +  ++    Y
Sbjct: 121 DDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAY 180

Query: 163 LALARA------EPGRFVVLDATLPEEEIARAIQAHL 193
            A          + G +  +DA+ P   +   I   L
Sbjct: 181 HAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKL 217


>1e2mB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 38.2 bits (87), Expect = 2e-05
 Identities = 26/193 (13%), Positives = 44/193 (22%), Gaps = 31/193 (16%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLL---------- 51
             L + ++G  G GKTT  + L A         +        +      +          
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL 62

Query: 52  --------LTQELSPEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLD--------S 95
                       +   A+  +               G  AG         D         
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC 122

Query: 96  SLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFF 155
             A +     +    +          L      L  LP +  + R+ +      L L   
Sbjct: 123 YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAK-----RLDLAML 177

Query: 156 RRVREGYLALARA 168
             +R  Y  LA  
Sbjct: 178 AAIRRVYGLLANT 190


>3blvH [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
          Length = 345

 Score = 37.3 bits (86), Expect = 4e-05
 Identities = 19/142 (13%), Positives = 36/142 (25%), Gaps = 20/142 (14%)

Query: 68  DRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLT 127
           + ++ V+K+     +A  V I     D S  +      +P P + +   +    LK  L 
Sbjct: 32  EISKSVKKI----FSAANVPIEWESCDVSPIFVNGLTTIPDPAV-QSITKNLVALKGPLA 86

Query: 128 FLLDLPPEAALRR-----------VRRPDRLEGLGLEFFRRVREGYLALARAEPG----R 172
             +       LR+                            +RE                
Sbjct: 87  TPIGRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG 146

Query: 173 FVVLDATLPEEEIARAIQAHLR 194
            V     +  +   R I+    
Sbjct: 147 VVQSIKLITRDASERVIRYAFE 168


>2bwjD [x.x.x] ADENYLATE KINASE 5
          Length = 192

 Score = 36.9 bits (84), Expect = 5e-05
 Identities = 14/60 (23%), Positives = 20/60 (33%), Gaps = 14/60 (23%)

Query: 2  PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
              + + G  GSGK TQ  +L                           LL +EL+ E+E
Sbjct: 6  KCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------GELLREELASESE 51


>2bwjF [x.x.x] ADENYLATE KINASE 5
          Length = 194

 Score = 36.2 bits (82), Expect = 8e-05
 Identities = 27/207 (13%), Positives = 64/207 (30%), Gaps = 34/207 (16%)

Query: 1   MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEA 60
                + + G  GSGK TQ  +L                           LL +EL+ E+
Sbjct: 5   RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------GELLREELASES 50

Query: 61  EYLLFSADRAEHVRKVILPGLAAGKVV----ISDRYLDSSLAYQGYGRGLPLPWLREVAR 116
           E       R++ +R ++  G      +    + +  + S    +G+        +++   
Sbjct: 51  E-------RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEE 103

Query: 117 EATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGY---------LALAR 167
              R   P+L   +D   +    R+ +  R      +  + + +           +    
Sbjct: 104 FGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYY 163

Query: 168 AEPGRFVVLDATLPEEEIARAIQAHLR 194
               +   ++A    E++   +   + 
Sbjct: 164 ETKTQLHKINAEGTPEDVFLQLCTAID 190


>1e2jB [c.37.1] THYMIDINE KINASE
          Length = 314

 Score = 35.5 bits (80), Expect = 1e-04
 Identities = 9/33 (27%), Positives = 13/33 (39%)

Query: 2  PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPV 34
            L + ++G  G GKTT  + L A         
Sbjct: 3  TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY 35


>3do6A [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
          Length = 530

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 9/40 (22%), Positives = 17/40 (42%)

Query: 1  MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREP 40
          +  +        G GKTT +  L++      + ++  REP
Sbjct: 44 LILVTAVTPTPAGEGKTTTSIGLSSLNRIGKKSIVTLREP 83


>2dwoA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 449

 Score = 33.9 bits (76), Expect = 4e-04
 Identities = 12/77 (15%), Positives = 24/77 (31%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
               + + GL   GKT  +++L  +L   G P  +          V+         P+ E
Sbjct: 29  SPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNE 88

Query: 62  YLLFSADRAEHVRKVIL 78
             +    +        +
Sbjct: 89  EAMKVRKQCALAALRDV 105


>3c95A [x.x.x] EXODEOXYRIBONUCLEASE I
          Length = 446

 Score = 33.5 bits (75), Expect = 6e-04
 Identities = 21/200 (10%), Positives = 43/200 (21%), Gaps = 32/200 (16%)

Query: 1   MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEA 60
              L      L    K     +           + + R+      +              
Sbjct: 266 SDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLK-------------- 311

Query: 61  EYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATR 120
                   R     +  +        + ++     +  Y G+        ++ V     R
Sbjct: 312 ------ILRENPQVREKV------VAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPR 359

Query: 121 GLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARA----EPGRFVVL 176
            L       +D   E  L   R  +    L     +R  E    +              L
Sbjct: 360 NLPALDITFVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTPEFLQGY--ADEL 417

Query: 177 DATLPEEEIARAIQAHLRPL 196
              + +    +   A L+ L
Sbjct: 418 QMLVQQYADDKEKVALLKAL 437


>1e9cA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score = 33.4 bits (75), Expect = 6e-04
 Identities = 34/197 (17%), Positives = 61/197 (30%), Gaps = 3/197 (1%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
            G  + LEG+D +GK+TQ+R+L   L A G    L R P       + L    +   + E
Sbjct: 2   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 61

Query: 62  YLLFSADRAEHVRKVILPGLAAGKVV-ISDRYLDSSLAYQGYGRGLPLPWLREVAREATR 120
                   + +  + +                  +       G             +   
Sbjct: 62  DHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGL 121

Query: 121 GLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATL 180
                + FL     +AA R     +R E     F  R    +  L +     + ++DA+ 
Sbjct: 122 PKPDLVLFLQLQLADAAKRGAFGHERYE--NGAFQERALRCFHQLMKDTTLNWKMVDASK 179

Query: 181 PEEEIARAIQAHLRPLL 197
             E +   I+      +
Sbjct: 180 SIEAVHEDIRVLSEDAI 196


>1e2iB [c.37.1] THYMIDINE KINASE
          Length = 313

 Score = 33.2 bits (74), Expect = 7e-04
 Identities = 31/196 (15%), Positives = 53/196 (27%), Gaps = 34/196 (17%)

Query: 2   PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAE 61
             L + ++G  G GKTT  + L A             EP      + +      +     
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY--VPEPMTYWRVLGASETIANIYTTQH 60

Query: 62  YLLFSADRAEHVRKVIL-------------------------PGLAAGKVVISDRYLDSS 96
            L      A     V+                                  +I DR+  ++
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAA 120

Query: 97  L----AYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGL 152
           L    A +     +    +          L      L  LP +  + R+ + +RL+   L
Sbjct: 121 LLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLD---L 177

Query: 153 EFFRRVREGYLALARA 168
                +R  Y  LA  
Sbjct: 178 AMLAAIRRVYGLLANT 193


>2cckA [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score = 33.1 bits (74), Expect = 7e-04
 Identities = 64/194 (32%), Positives = 95/194 (48%), Gaps = 7/194 (3%)

Query: 5   FLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLL 64
           F+T EG +GSGKTT    +   L      ++     G    E    ++ +++    E +L
Sbjct: 3   FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEAML 62

Query: 65  FSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKP 124
           F+A R EH+   ++P L  GKVV+ DRY+DSSLAYQGY RG+ +  +R +   A  GL P
Sbjct: 63  FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYP 122

Query: 125 RLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVL-DATLPEE 183
            LT  L++  E    R+ +  RL+   L+F  +V EGY  + R       V  D  L  E
Sbjct: 123 DLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIR----FKSVNADQPL--E 176

Query: 184 EIARAIQAHLRPLL 197
            +       +   L
Sbjct: 177 NVVEDTYQTIIKYL 190


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.322    0.142    0.412 

Gapped
Lambda     K      H
   0.267   0.0451    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 13,580,784
Number of extensions: 812556
Number of successful extensions: 9737
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4901
Number of HSP's successfully gapped: 219
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)