RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAS81794.1 tthe0 AAS81794.1 GIB00176CH01 "acyl-CoA hydrolase"
         (125 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3b7kA [x.x.x] ACYL-COENZYME A THIOESTERASE 12                          86   4e-20
3bjkA [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827                      71   2e-15
3bjkC [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827                      71   2e-15
3bjkD [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827                      70   3e-15
3b7kB [x.x.x] ACYL-COENZYME A THIOESTERASE 12                          69   6e-15
3bjkF [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827                      66   5e-14
3bjkB [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827                      63   4e-13
3d6lA [x.x.x] PUTATIVE HYDROLASE                                       63   5e-13
3b7kC [x.x.x] ACYL-COENZYME A THIOESTERASE 12                          61   2e-12
2aliA [x.x.x] HYPOTHETICAL PROTEIN PA2801                              60   4e-12
3cjyA [x.x.x] PUTATIVE THIOESTERASE                                    60   5e-12
2eisA [x.x.x] HYPOTHETICAL PROTEIN TTHB207                             59   8e-12
2aelA [x.x.x] TRICHODIENE SYNTHASE                                     58   2e-11
3e1eC [x.x.x] THIOESTERASE FAMILY PROTEIN                              56   5e-11
3e1eA [x.x.x] THIOESTERASE FAMILY PROTEIN                              55   9e-11
3e1eD [x.x.x] THIOESTERASE FAMILY PROTEIN                              54   2e-10
2cyeA [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846                 54   2e-10
3d6xC [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]             54   3e-10
3e1eB [x.x.x] THIOESTERASE FAMILY PROTEIN                              54   3e-10
2aelB [x.x.x] TRICHODIENE SYNTHASE                                     54   3e-10
2egiA [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             53   4e-10
3dkzB [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN                         53   5e-10
2b6eD [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161                      53   6e-10
2cy9A [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2                        52   9e-10
2cyeD [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846                 51   2e-09
2egiH [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             51   2e-09
2egiG [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             51   2e-09
2egiD [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             50   3e-09
2egjA [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             50   3e-09
1bvqA [d.38.1] PROTEIN (4-HYDROXYBENZOYL COA THIOESTERASE)             50   3e-09
2egiE [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             49   6e-09
2cwzB [x.x.x] THIOESTERASE FAMILY PROTEIN                              49   6e-09
3d6xE [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]             49   8e-09
2egiI [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             48   1e-08
3d6xF [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]             48   1e-08
3ck1A [x.x.x] PUTATIVE THIOESTERASE                                    48   1e-08
2egiF [x.x.x] HYPOTHETICAL PROTEIN AQ_1494                             48   1e-08
2cwzA [x.x.x] THIOESTERASE FAMILY PROTEIN                              47   3e-08
2av9A [x.x.x] THIOESTERASE                                             47   4e-08
2b6eA [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161                      47   4e-08
2av9E [x.x.x] THIOESTERASE                                             46   5e-08
3bnvD [x.x.x] CJ0977                                                   46   5e-08
3dkzA [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN                         46   6e-08
3bnvA [x.x.x] CJ0977                                                   46   7e-08
2av9D [x.x.x] THIOESTERASE                                             46   7e-08
3bnvB [x.x.x] CJ0977                                                   46   7e-08
3d6xB [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]             46   7e-08
2av9J [x.x.x] THIOESTERASE                                             45   9e-08
3bnvF [x.x.x] CJ0977                                                   45   9e-08
3e29B [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR                     45   9e-08
2cyeC [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846                 45   1e-07
2dslA [x.x.x] PHENYLACETIC ACID DEGRADATION PROTEIN PAAI               45   1e-07
3bnvH [x.x.x] CJ0977                                                   45   1e-07
3b7jB [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN               45   1e-07
1c8uA [d.38.1 - d.38.1] ACYL-COA THIOESTERASE II                       45   2e-07
3bnvG [x.x.x] CJ0977                                                   44   2e-07
3d6xD [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]             44   2e-07
3d6xA [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]             44   2e-07
2b6eB [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161                      44   3e-07
2av9H [x.x.x] THIOESTERASE                                             44   3e-07
3d04B [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN               44   3e-07
3e29D [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR                     43   4e-07
3dp3D [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN               43   4e-07
2cy9B [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2                        43   6e-07
2av9B [x.x.x] THIOESTERASE                                             42   9e-07
2av9G [x.x.x] THIOESTERASE                                             42   1e-06
3b7jC [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN               42   1e-06
3e8pA [x.x.x] UNCHARACTERIZED PROTEIN                                  42   1e-06
2bi0A [x.x.x] HYPOTHETICAL PROTEIN RV0216                              41   2e-06
3dozD [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN               40   3e-06
3d04F [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN               40   4e-06
3e29A [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR                     39   9e-06
3bbjA [x.x.x] PUTATIVE THIOESTERASE II                                 37   3e-05
3bbjB [x.x.x] PUTATIVE THIOESTERASE II                                 37   4e-05
2c2iA [x.x.x] RV0130                                                   35   1e-04

>3b7kA [x.x.x] ACYL-COENZYME A THIOESTERASE 12
          Length = 267

 Score = 86.4 bits (213), Expect = 4e-20
 Identities = 26/118 (22%), Positives = 42/118 (35%), Gaps = 2/118 (1%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIR 60
              +++ELV P H N             M+ V + +A+R         +V   +F+ P  
Sbjct: 150 TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPST 209

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKE--RFGEGNGRVLATQGVLTYVAVNEKGEPV 116
            GD L   A V    +T + V V V     +              L Y A ++K   +
Sbjct: 210 VGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLI 267



 Score = 78.3 bits (192), Expect = 1e-17
 Identities = 24/110 (21%), Positives = 44/110 (40%), Gaps = 1/110 (0%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
           E    + + P H               +D     AA + A    VT +V  ++F+   R 
Sbjct: 4   EVVMSQAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQFEETARV 63

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNE 111
           G ++ + A+V R   TS+ + ++V  +    G  + L +    T+VA   
Sbjct: 64  GQVITIKAKVTRAFSTSMEISIKVMVQDMLTGIEK-LVSVAFSTFVAKPV 112


>3bjkA [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
          Length = 140

 Score = 70.7 bits (173), Expect = 2e-15
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 2/119 (1%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
                 L  P  TN             M   G+  A   A   VVTVAV S+ F  PI  
Sbjct: 4   VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISV 63

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNG--RVLATQGVLTYVAVNEKGEPVPV 118
           GD++    + ++VGR+S+ ++VEV+ ++        R   T  V T+VAV+  G    +
Sbjct: 64  GDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRSRTI 122


>3bjkC [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
          Length = 142

 Score = 70.7 bits (173), Expect = 2e-15
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 2/119 (1%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
                 L  P  TN             M   G+  A   A   VVTVAV S+ F  PI  
Sbjct: 6   VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISV 65

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGE--GNGRVLATQGVLTYVAVNEKGEPVPV 118
           GD++    + ++VGR+S+ ++VEV+ ++        R   T  V T+VAV+  G    +
Sbjct: 66  GDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRSRTI 124


>3bjkD [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
          Length = 139

 Score = 70.3 bits (172), Expect = 3e-15
 Identities = 34/120 (28%), Positives = 50/120 (41%), Gaps = 4/120 (3%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
                 L  P  TN             M   G+  A   A   VVTVAV S+ F  PI  
Sbjct: 3   VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISV 62

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVY---KERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
           GD++    + ++VGR+S+ ++VEV+         G    +    V T+VAV+  G    +
Sbjct: 63  GDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTD-AVFTFVAVDNNGRSRTI 121


>3b7kB [x.x.x] ACYL-COENZYME A THIOESTERASE 12
          Length = 247

 Score = 69.1 bits (168), Expect = 6e-15
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 2/108 (1%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIR 60
              +++ELV P H N             M+ V + +A+R         +V   +F+ P  
Sbjct: 142 TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPST 201

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVA 108
            GD L   A V       + VE    +E   EG GR + +   L Y A
Sbjct: 202 VGDRLVFTAIVNNCVEVGVRVEAFDCQEW-AEGRGRHINS-AFLIYNA 247



 Score = 55.7 bits (133), Expect = 7e-11
 Identities = 18/82 (21%), Positives = 35/82 (42%)

Query: 7  ELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLE 66
          + + P H               +D     AA + A    VT +V  ++F+   R G ++ 
Sbjct: 5  QAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQFEETARVGQVIT 64

Query: 67 VVARVVRVGRTSLTVEVEVYKE 88
          + A+V R   TS+ + ++V  +
Sbjct: 65 IKAKVTRAFSTSMEISIKVMVQ 86


>3bjkF [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
          Length = 138

 Score = 66.1 bits (161), Expect = 5e-14
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 4/120 (3%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
                 L  P  TN             M   G+  A   A   VVTVAV S+ F  PI  
Sbjct: 6   VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISV 65

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVY---KERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
           GD++    + ++VGR+S+ ++VEV+         G    +    V T+VAV+  G  +P 
Sbjct: 66  GDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTD-AVFTFVAVDNNGRTIPR 124


>3bjkB [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
          Length = 142

 Score = 63.0 bits (153), Expect = 4e-13
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 9   VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVV 68
             P  TN             M   G+  A   A   VVTVAV S+ F  PI  GD++   
Sbjct: 14  AMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCY 73

Query: 69  ARVVRVGRTSLTVEVEVY---KERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
            + ++VGR+S+ ++VEV+         G    +    V T+VAV+  G    +
Sbjct: 74  GQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTD-AVFTFVAVDNNGRSRTI 125


>3d6lA [x.x.x] PUTATIVE HYDROLASE
          Length = 133

 Score = 62.8 bits (152), Expect = 5e-13
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 2/119 (1%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
           E +   +  P  TNP            +D  G+ AA   +   VVT+++  V FK P+  
Sbjct: 5   EPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFKEPVFI 64

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNG--RVLATQGVLTYVAVNEKGEPVPV 118
           GD++   ++VV VG TS++VEVEV  +R         +  T  ++TYV+V   G+  P+
Sbjct: 65  GDIISCYSKVVNVGNTSISVEVEVTAQRVDSQGCTSCINVTSALVTYVSVTRDGKKNPI 123


>3b7kC [x.x.x] ACYL-COENZYME A THIOESTERASE 12
          Length = 255

 Score = 60.7 bits (146), Expect = 2e-12
 Identities = 24/110 (21%), Positives = 40/110 (36%), Gaps = 6/110 (5%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIR 60
              +++ELV P H N             M+ V + +A+R         +V   +F+ P  
Sbjct: 146 TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPST 205

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN 110
            GD L   A V    +T + V V V        + +  A  G   ++   
Sbjct: 206 VGDRLVFTAIVNNTFQTCVEVGVRVEAF-----DCQEWAE-GRGRHINSA 249



 Score = 51.8 bits (123), Expect = 1e-09
 Identities = 19/87 (21%), Positives = 36/87 (41%)

Query: 2  EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
          E    + + P H               +D     AA + A    VT +V  ++F+   R 
Sbjct: 3  EVVMSQAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQFEETARV 62

Query: 62 GDLLEVVARVVRVGRTSLTVEVEVYKE 88
          G ++ + A+V R   TS+ + ++V  +
Sbjct: 63 GQVITIKAKVTRAFSTSMEISIKVMVQ 89


>2aliA [x.x.x] HYPOTHETICAL PROTEIN PA2801
          Length = 129

 Score = 60.0 bits (145), Expect = 4e-12
 Identities = 15/120 (12%), Positives = 29/120 (24%), Gaps = 10/120 (8%)

Query: 5   TLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAK-----RPVVTVAVGSVEFKVPI 59
           T  +      +             +++                     V      +  P+
Sbjct: 5   TAHIPVRWGDDSYGHVNNTLYFQYLEEARVAWFETLGIDLEGAAEGPVVLQSLHTYLKPV 64

Query: 60  RTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKGEPVPV 118
                + V     R+G +SL +E  ++     E         G    V V   +    PV
Sbjct: 65  VHPATVVVELYAGRLGTSSLVLEHRLHTL---EDPQGTYGE-GHCKLVWVRHAENRSTPV 120


>3cjyA [x.x.x] PUTATIVE THIOESTERASE
          Length = 249

 Score = 59.6 bits (144), Expect = 5e-12
 Identities = 16/117 (13%), Positives = 31/117 (26%), Gaps = 15/117 (12%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A T+                      +D                 V  GS++F      
Sbjct: 13  YAITVGPDLAVGPPGHAYLFGGASALALDVAAE--------TVGRPVVQGSLQFVSFTPL 64

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
           G +L++   V++ GRT     V    +      GR++     ++            +
Sbjct: 65  GSVLDLTVEVLQSGRTLAQARVAGTVD------GRLVFH-SGISLGREGFSARQWAL 114


>2eisA [x.x.x] HYPOTHETICAL PROTEIN TTHB207
          Length = 117

 Score = 58.9 bits (142), Expect = 8e-12
 Identities = 37/112 (33%), Positives = 49/112 (43%), Gaps = 3/112 (2%)

Query: 7   ELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLE 66
             VFP  TN                    A  R A++ VVTV   +V+FK P+  G ++E
Sbjct: 5   YPVFPGETNHYGTLFGGTVLAWDQAAFVAAT-RHARKKVVTVHADAVDFKRPVPLGAIVE 63

Query: 67  VVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
           +VAR+  VGRTS      V           + A  G    VAV+E+G P PV
Sbjct: 64  LVARLKEVGRTSRVEVEWVE-PVKEGEEAYLAAR-GGFVLVAVDERGRPSPV 113


>2aelA [x.x.x] TRICHODIENE SYNTHASE
          Length = 352

 Score = 57.8 bits (139), Expect = 2e-11
 Identities = 13/115 (11%), Positives = 22/115 (19%), Gaps = 11/115 (9%)

Query: 8   LVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEV 67
             F    N                             +   +  +      +   DL+  
Sbjct: 176 PQFLRRMNGLGHCVGASLWPKEQFNERS-------LFLEITSAIAQMENWMVWVNDLMSF 228

Query: 68  VARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVL----TYVAVNEKGEPVPV 118
                        V+  V  +           TQ  L      VAV    +P  +
Sbjct: 229 YKEFDDERDQISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVM 283


>3e1eC [x.x.x] THIOESTERASE FAMILY PROTEIN
          Length = 141

 Score = 56.1 bits (135), Expect = 5e-11
 Identities = 17/88 (19%), Positives = 22/88 (25%), Gaps = 2/88 (2%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIR 60
                       T              +D    YAA    +     + V   V F  P  
Sbjct: 35  RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEFKVNFLNPAE 94

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKE 88
            G+     A VV+ GRT        Y  
Sbjct: 95  -GERFAFRAEVVKPGRTLTVATATAYAF 121


>3e1eA [x.x.x] THIOESTERASE FAMILY PROTEIN
          Length = 136

 Score = 55.4 bits (133), Expect = 9e-11
 Identities = 21/100 (21%), Positives = 28/100 (28%), Gaps = 4/100 (4%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIR 60
                       T              +D    YAA    +     + V   V F  P  
Sbjct: 30  RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEFKVNFLNPAE 89

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLAT 100
            G+     A VV+ GRT        Y     +G  R +AT
Sbjct: 90  -GERFAFRAEVVKPGRTLTVATATAYAF--RDGEERAIAT 126


>3e1eD [x.x.x] THIOESTERASE FAMILY PROTEIN
          Length = 137

 Score = 54.2 bits (130), Expect = 2e-10
 Identities = 17/88 (19%), Positives = 22/88 (25%), Gaps = 2/88 (2%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIR 60
                       T              +D    YAA    +     + V   V F  P  
Sbjct: 31  RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEFKVNFLNPAE 90

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKE 88
            G+     A VV+ GRT        Y  
Sbjct: 91  -GERFAFRAEVVKPGRTLTVATATAYAF 117


>2cyeA [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
          Length = 126

 Score = 54.2 bits (130), Expect = 2e-10
 Identities = 21/90 (23%), Positives = 31/90 (34%), Gaps = 9/90 (10%)

Query: 29  MDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKE 88
                 Y            V    V++  PI  GD + V  R V +GR+SL   +     
Sbjct: 31  ELARIRYFQRIDWLEEGHFVVAREVDYLRPILLGDEVFVGVRTVGLGRSSLREHLVTANG 90

Query: 89  RFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
                     A +G+   V + E G P P+
Sbjct: 91  E--------SAAKGLGVLVWL-EGGRPAPL 111


>3d6xC [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
          Length = 132

 Score = 53.9 bits (129), Expect = 3e-10
 Identities = 14/97 (14%), Positives = 27/97 (27%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
           +  ++      H                   G  A      + V    +   +F+ P+R 
Sbjct: 34  KNISISDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESPKSKVVYFTGIDGAKFRNPVRP 93

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
           GD L+  + V   G      +  V      E   + +
Sbjct: 94  GDRLDYESVVKNRGNWIFKGQAFVDGNLVAEAELKAI 130


>3e1eB [x.x.x] THIOESTERASE FAMILY PROTEIN
          Length = 140

 Score = 53.8 bits (129), Expect = 3e-10
 Identities = 18/89 (20%), Positives = 23/89 (25%), Gaps = 2/89 (2%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIR 60
                       T              +D    YAA    +     + V   V F  P  
Sbjct: 34  RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEFKVNFLNPAE 93

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKER 89
            G+     A VV+ GRT        Y  R
Sbjct: 94  -GERFAFRAEVVKPGRTLTVATATAYAFR 121


>2aelB [x.x.x] TRICHODIENE SYNTHASE
          Length = 353

 Score = 53.6 bits (128), Expect = 3e-10
 Identities = 13/115 (11%), Positives = 22/115 (19%), Gaps = 11/115 (9%)

Query: 8   LVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEV 67
             F    N                             +   +  +      +   DL+  
Sbjct: 177 PQFLRRMNGLGHCVGASLWPKEQFNERS-------LFLEITSAIAQMENWMVWVNDLMSF 229

Query: 68  VARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVL----TYVAVNEKGEPVPV 118
                        V+  V  +           TQ  L      VAV    +P  +
Sbjct: 230 YKEFDDERDQISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVM 284


>2egiA [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 123

 Score = 53.1 bits (127), Expect = 4e-10
 Identities = 15/87 (17%), Positives = 27/87 (31%), Gaps = 7/87 (8%)

Query: 32  VGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFG 91
            G   +  R     V +     E+K P+   D+ EV   +  + R + T    V+     
Sbjct: 39  KGFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEELSRFTFTFSYIVF----- 93

Query: 92  EGNGRVLATQGVLTYVAVNEKGEPVPV 118
                +   +    +  V     P  V
Sbjct: 94  --KEDIAVAKANTKHCMVKIVSIPKEV 118


>3dkzB [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN
          Length = 120

 Score = 53.0 bits (127), Expect = 5e-10
 Identities = 18/108 (16%), Positives = 31/108 (28%), Gaps = 11/108 (10%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            ART      +  N                +G+       +  V T+         P R 
Sbjct: 24  TARTRLPARADLVNSRGDIHGGTLSVLDFTLGAAIRGDTPEVGVATI---DNTSFSPGRG 80

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAV 109
              L +  R +R G +    E E+         G ++A     T+  +
Sbjct: 81  D--LVIETRCLRRGASIAFCEGEIRDS-----AGELVAK-ATATFKII 120


>2b6eD [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
          Length = 143

 Score = 52.7 bits (126), Expect = 6e-10
 Identities = 16/112 (14%), Positives = 34/112 (30%), Gaps = 8/112 (7%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIR 60
           E           T P             + +GS A +   +     V +  +     P+R
Sbjct: 32  EDWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVR 91

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEK 112
           +G +    A  + +GR     ++++          ++      LT   +N  
Sbjct: 92  SGKVT-ARATPINLGRNIQVWQIDIRT-----EENKLCCV-SRLTLSVINLL 136


>2cy9A [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
          Length = 116

 Score = 52.1 bits (125), Expect = 9e-10
 Identities = 17/98 (17%), Positives = 36/98 (36%), Gaps = 13/98 (13%)

Query: 9   VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVV 68
           V  +HTN             +D + +             V+V ++ +      G+ + + 
Sbjct: 29  VEEQHTNKLGTLHGGLTATLVDSISTALCT-------PGVSVDNITYSPAKI-GEEIVIT 80

Query: 69  ARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTY 106
           A +++ G+T     V++  +  G+     L  QG  T 
Sbjct: 81  AHILKQGKTLAFASVDLTNKTTGK-----LIAQGRHTK 113


>2cyeD [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
          Length = 122

 Score = 51.0 bits (122), Expect = 2e-09
 Identities = 21/92 (22%), Positives = 31/92 (33%), Gaps = 11/92 (11%)

Query: 29  MDKVGSYAAAR--RAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVY 86
                 Y              V    V++  PI  GD + V  R V +GR+SL   +   
Sbjct: 30  ELARIRYFQRISPDWLEEGHFVVAREVDYLRPILLGDEVFVGVRTVGLGRSSLREHLVTA 89

Query: 87  KERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
                       A +G+   V + E G P P+
Sbjct: 90  NGE--------SAAKGLGVLVWL-EGGRPAPL 112


>2egiH [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 97

 Score = 51.0 bits (122), Expect = 2e-09
 Identities = 14/101 (13%), Positives = 28/101 (27%), Gaps = 11/101 (10%)

Query: 9   VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVV 68
           V    T+              +     A     +   V +     E+K P+   D+ EV 
Sbjct: 7   VQFYETDAQGIVHHSNYFRYFE----EARGEFLRSKEVVLLNAYCEYKKPLFYDDVFEVH 62

Query: 69  ARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAV 109
             +  + R + T    V+          +   +    +  V
Sbjct: 63  LNLEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMV 96


>2egiG [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 113

 Score = 50.7 bits (121), Expect = 2e-09
 Identities = 13/85 (15%), Positives = 22/85 (25%), Gaps = 13/85 (15%)

Query: 33  GSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGE 92
           G   +  R     V +     E+K P+   D+ EV   +       +  E          
Sbjct: 39  GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLNLTFTFSYIVFKEDIA------- 91

Query: 93  GNGRVLATQGVLTYVAVNEKGEPVP 117
                   +    +  V     PV 
Sbjct: 92  ------VAKANTKHCMVKIVSIPVL 110


>2egiD [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 125

 Score = 50.4 bits (120), Expect = 3e-09
 Identities = 16/121 (13%), Positives = 33/121 (27%), Gaps = 16/121 (13%)

Query: 9   VFPEHTNPXXXXXXXXXXXXMDKVGSYA--------AARRAKRPVVTVAVGSVEFKVPIR 60
           V    T+              ++             +  R     V +     E+K P+ 
Sbjct: 7   VQFYETDAQGIVHHSNYFRYFEEARGEFLRSKGFPYSKMRDMGLEVVLLNAYCEYKKPLF 66

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVEA 120
             D+ EV   +  + R + T    V+          +   +    +  V   G+ V +  
Sbjct: 67  YDDVFEVHLNLEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMVK-NGKIVSIPK 118

Query: 121 H 121
            
Sbjct: 119 E 119


>2egjA [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 126

 Score = 50.4 bits (120), Expect = 3e-09
 Identities = 15/89 (16%), Positives = 29/89 (32%), Gaps = 8/89 (8%)

Query: 33  GSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGE 92
           G   +  R     V +     E+K P+   D+ EV   +  + R + T    V+      
Sbjct: 40  GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEELSRFTFTFSYIVF------ 93

Query: 93  GNGRVLATQGVLTYVAVNEKGEPVPVEAH 121
               +   +    +  V   G+ V +   
Sbjct: 94  -KEDIAVAKANTKHCMVK-NGKIVSIPKE 120


>1bvqA [d.38.1] PROTEIN (4-HYDROXYBENZOYL COA THIOESTERASE)
          Length = 139

 Score = 50.1 bits (119), Expect = 3e-09
 Identities = 10/83 (12%), Positives = 22/83 (26%), Gaps = 5/83 (6%)

Query: 39  RRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
                    +   +  F       D+L +   +    R S      V +     G+ +++
Sbjct: 51  VERGIVGTPIVSCNASFVCTASYDDVLTIETCIKEWRRKSFVQRHSVSRTT-PGGDVQLV 109

Query: 99  ATQGVLTYVAVN---EKGEPVPV 118
                   V      E+   + V
Sbjct: 110 MR-ADEIRVFAMNDGERLRAIEV 131


>2egiE [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 125

 Score = 49.2 bits (117), Expect = 6e-09
 Identities = 15/89 (16%), Positives = 29/89 (32%), Gaps = 8/89 (8%)

Query: 33  GSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGE 92
           G   +  R     V +     E+K P+   D+ EV   +  + R + T    V+      
Sbjct: 40  GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEELSRFTFTFSYIVF------ 93

Query: 93  GNGRVLATQGVLTYVAVNEKGEPVPVEAH 121
               +   +    +  V   G+ V +   
Sbjct: 94  -KEDIAVAKANTKHCMVK-NGKIVSIPKE 120


>2cwzB [x.x.x] THIOESTERASE FAMILY PROTEIN
          Length = 132

 Score = 49.2 bits (117), Expect = 6e-09
 Identities = 13/120 (10%), Positives = 22/120 (18%), Gaps = 10/120 (8%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDK---VGSYAAARRAKRPVVTVAVGSVEFKVP 58
              T+                      +               +      +         
Sbjct: 10  VFETVVTPETVRFEELGPVHPVYATYWVKHELAGRKIILPFLEEGEEGIGSYVEARHLAS 69

Query: 59  IRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
              G +  VVAR  +     +   VE Y E         L   G    V + +       
Sbjct: 70  ALPGRVR-VVARHEKTEGNRVYARVEAYNEL------GDLIGVGRTEQVILPKAKVEALF 122


>3d6xE [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
          Length = 132

 Score = 48.9 bits (116), Expect = 8e-09
 Identities = 14/92 (15%), Positives = 24/92 (26%)

Query: 7   ELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLE 66
                 H                   G  A      + V    +   +F+ P+R GD L+
Sbjct: 39  SDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESEKSKVVYFTGIDGAKFRNPVRPGDRLD 98

Query: 67  VVARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
             + V   G      +  V      E   + +
Sbjct: 99  YESVVKNRGNWIFKGQAFVDGNLVAEAELKAI 130


>2egiI [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 98

 Score = 48.4 bits (115), Expect = 1e-08
 Identities = 11/91 (12%), Positives = 25/91 (27%), Gaps = 3/91 (3%)

Query: 9  VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVV 68
          V    T+              ++        +     V +     E+K P+   D+ EV 
Sbjct: 8  VQFYETDAQGIVHHSNYFRYFEEARGEFLRSKL---EVVLLNAYCEYKKPLFYDDVFEVH 64

Query: 69 ARVVRVGRTSLTVEVEVYKERFGEGNGRVLA 99
            +  +   + +  V        + N +   
Sbjct: 65 LNLEELSTFTFSYIVFKEDIAVAKANTKHCM 95


>3d6xF [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
          Length = 131

 Score = 48.1 bits (114), Expect = 1e-08
 Identities = 14/92 (15%), Positives = 24/92 (26%)

Query: 7   ELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLE 66
                 H                   G  A      + V    +   +F+ P+R GD L+
Sbjct: 39  SDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESEKSKVVYFTGIDGAKFRNPVRPGDRLD 98

Query: 67  VVARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
             + V   G      +  V      E   + +
Sbjct: 99  YESVVKNRGNWIFKGQAFVDGNLVAEAELKAI 130


>3ck1A [x.x.x] PUTATIVE THIOESTERASE
          Length = 138

 Score = 48.1 bits (114), Expect = 1e-08
 Identities = 22/91 (24%), Positives = 35/91 (38%), Gaps = 8/91 (8%)

Query: 29  MDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKE 88
              +     A  A +  V  A     F  P R G+ L    RVV++G++S TV+V    +
Sbjct: 39  AQALDWPFDAHGAGQAGVPTADLHCRFVAPSRLGETLTRELRVVKLGQSSFTVQVRFGPD 98

Query: 89  RFGEGNGRVLATQGVLTYVAVN-EKGEPVPV 118
                   +         V V+ +K  P P+
Sbjct: 99  ------SGLRLE-VTQRLVCVDTDKIAPRPL 122


>2egiF [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
          Length = 123

 Score = 48.1 bits (114), Expect = 1e-08
 Identities = 15/86 (17%), Positives = 30/86 (34%), Gaps = 8/86 (9%)

Query: 33  GSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGE 92
           G   +  R     V +     E+K P+   D+ EV   +  + R + T    V+      
Sbjct: 40  GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEELSRFTFTFSYIVF------ 93

Query: 93  GNGRVLATQGVLTYVAVNEKGEPVPV 118
               +   +    +  V + G+ V +
Sbjct: 94  -KEDIAVAKANTKHCMV-KNGKIVSI 117


>2cwzA [x.x.x] THIOESTERASE FAMILY PROTEIN
          Length = 133

 Score = 46.9 bits (111), Expect = 3e-08
 Identities = 13/113 (11%), Positives = 21/113 (18%), Gaps = 10/113 (8%)

Query: 9   VFPEHTNPXXXXXXXXXXXX--MDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIRTGDLL 65
                                  +  G        +     +              G + 
Sbjct: 17  PETVRFEELGPVHPVYATYWVKHELAGRKIILPFLEEGEEGIGSYVEARHLASALPGRVR 76

Query: 66  EVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPV 118
            VVAR  +     +   VE Y E         L   G    V + +       
Sbjct: 77  -VVARHEKTEGNRVYARVEAYNEL------GDLIGVGRTEQVILPKAKVEALF 122


>2av9A [x.x.x] THIOESTERASE
          Length = 141

 Score = 46.6 bits (110), Expect = 4e-08
 Identities = 18/125 (14%), Positives = 34/125 (27%), Gaps = 13/125 (10%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVE 54
                         +              D   +           +    +  V   S +
Sbjct: 8   YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCD 67

Query: 55  FKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKG 113
           +  P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V     
Sbjct: 68  YFAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSS 121

Query: 114 EPVPV 118
            PV +
Sbjct: 122 RPVAI 126


>2b6eA [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
          Length = 134

 Score = 46.6 bits (110), Expect = 4e-08
 Identities = 17/110 (15%), Positives = 35/110 (31%), Gaps = 8/110 (7%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVG-SVEFKVPIR 60
           E           T P             + +GS A +   +     V +  +     P+R
Sbjct: 32  EDWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVR 91

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN 110
           +G +    A  + +GR     ++++  E       ++      LT   +N
Sbjct: 92  SGKVT-ARATPINLGRNIQVWQIDIRTE-----ENKLCCV-SRLTLSVIN 134


>2av9E [x.x.x] THIOESTERASE
          Length = 136

 Score = 46.2 bits (109), Expect = 5e-08
 Identities = 18/124 (14%), Positives = 34/124 (27%), Gaps = 13/124 (10%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVEF 55
                        +              D   +           +    +  V   S ++
Sbjct: 7   LHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCDY 66

Query: 56  KVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKGE 114
             P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V      
Sbjct: 67  FAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSSR 120

Query: 115 PVPV 118
           PV +
Sbjct: 121 PVAI 124


>3bnvD [x.x.x] CJ0977
          Length = 141

 Score = 46.2 bits (109), Expect = 5e-08
 Identities = 15/113 (13%), Positives = 33/113 (29%), Gaps = 11/113 (9%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A+++ +   E  +              +    Y A     +    +      F  P++ 
Sbjct: 39  YAKSILITTSEVADDQGLIFDAFIFAAAN----YVAQASINKEFSVIIGSKCFFYAPLKL 94

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGE 114
           GD+LE+ A  +    +       V           +    G +  V+ +E   
Sbjct: 95  GDVLELEAHALFDETSKKRDVKVVG------HVKEIKFE-GTIQVVSTDEHIF 140


>3dkzA [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN
          Length = 121

 Score = 46.1 bits (109), Expect = 6e-08
 Identities = 17/108 (15%), Positives = 30/108 (27%), Gaps = 11/108 (10%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            ART      +  N                +G+       +  V T+         P R 
Sbjct: 24  TARTRLPARADLVNSRGDIHGGTLSVLDFTLGAAIRGDTPEVGVATI---DNTSFSPGRG 80

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAV 109
             ++E   R +R G +    E E+            L  +   T+  +
Sbjct: 81  DLVIE--TRCLRRGASIAFCEGEIRDSA------GELVAKATATFKII 120


>3bnvA [x.x.x] CJ0977
          Length = 140

 Score = 45.8 bits (108), Expect = 7e-08
 Identities = 14/111 (12%), Positives = 32/111 (28%), Gaps = 11/111 (9%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A+++ +   E  +              +      A     +    +      F  P++ 
Sbjct: 38  YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKL 93

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEK 112
           GD+LE+ A  +    +       V           +    G +  V+ +E 
Sbjct: 94  GDVLELEAHALFDETSKKRDVKVVG------HVKEIKFE-GTIQVVSTDEH 137


>2av9D [x.x.x] THIOESTERASE
          Length = 141

 Score = 45.8 bits (108), Expect = 7e-08
 Identities = 18/125 (14%), Positives = 34/125 (27%), Gaps = 13/125 (10%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVE 54
                         +              D   +           +    +  V   S +
Sbjct: 10  YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCD 69

Query: 55  FKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKG 113
           +  P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V     
Sbjct: 70  YFAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSS 123

Query: 114 EPVPV 118
            PV +
Sbjct: 124 RPVAI 128


>3bnvB [x.x.x] CJ0977
          Length = 135

 Score = 45.8 bits (108), Expect = 7e-08
 Identities = 12/88 (13%), Positives = 29/88 (32%), Gaps = 4/88 (4%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A+++ +   E  +              + V   +  +        +      F  P++ 
Sbjct: 37  YAKSILITTSEVADDQGLIFDAFIFAAANYVAQASINKE----FSVIIGSKCFFYAPLKL 92

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKER 89
           GD+LE+ A  ++     +   V+  K  
Sbjct: 93  GDVLELEAHALKKRDVKVVGHVKEIKFE 120


>3d6xB [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
          Length = 133

 Score = 45.8 bits (108), Expect = 7e-08
 Identities = 15/91 (16%), Positives = 25/91 (27%), Gaps = 1/91 (1%)

Query: 9   VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAK-RPVVTVAVGSVEFKVPIRTGDLLEV 67
               H                   G  A     K + V    +   +F+ P+R GD L+ 
Sbjct: 41  HVFGHFPGHPIYPGVLILEGAQTGGVLAFESEPKSKVVYFTGIDGAKFRNPVRPGDRLDY 100

Query: 68  VARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
            + V   G      +  V      E   + +
Sbjct: 101 ESVVKNRGNWIFKGQAFVDGNLVAEAELKAI 131


>2av9J [x.x.x] THIOESTERASE
          Length = 137

 Score = 45.4 bits (107), Expect = 9e-08
 Identities = 18/125 (14%), Positives = 34/125 (27%), Gaps = 13/125 (10%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVE 54
                         +              D   +           +    +  V   S +
Sbjct: 7   YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCD 66

Query: 55  FKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKG 113
           +  P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V     
Sbjct: 67  YFAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSS 120

Query: 114 EPVPV 118
            PV +
Sbjct: 121 RPVAI 125


>3bnvF [x.x.x] CJ0977
          Length = 137

 Score = 45.4 bits (107), Expect = 9e-08
 Identities = 14/111 (12%), Positives = 32/111 (28%), Gaps = 11/111 (9%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A+++ +   E  +              +      A     +    +      F  P++ 
Sbjct: 35  YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKL 90

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEK 112
           GD+LE+ A  +    +       V           +    G +  V+ +E 
Sbjct: 91  GDVLELEAHALFDETSKKRDVKVVGHV------KEIKFE-GTIQVVSTDEH 134


>3e29B [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
          Length = 129

 Score = 45.3 bits (107), Expect = 9e-08
 Identities = 20/109 (18%), Positives = 34/109 (31%), Gaps = 11/109 (10%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIR 60
           +            +              +D  G YA A +   PV T     V++     
Sbjct: 31  IVLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTD---HVDYHRVAT 87

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAV 109
            GDL     +V+  G+   T    V  +      G ++A+ G   Y+  
Sbjct: 88  PGDLR-AEGQVIHFGKRFATAHARVLDD------GNLVAS-GRALYLIR 128


>2cyeC [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
          Length = 129

 Score = 45.3 bits (107), Expect = 1e-07
 Identities = 19/83 (22%), Positives = 30/83 (36%), Gaps = 9/83 (10%)

Query: 36  AAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNG 95
             +         V    V++  PI  GD + V  R V +GR+SL   +            
Sbjct: 40  RISPDWLEEGHFVVAREVDYLRPILLGDEVFVGVRTVGLGRSSLREHLVTANGE------ 93

Query: 96  RVLATQGVLTYVAVNEKGEPVPV 118
              A +G+   V +   G P P+
Sbjct: 94  --SAAKGLGVLVWLE-GGRPAPL 113


>2dslA [x.x.x] PHENYLACETIC ACID DEGRADATION PROTEIN PAAI
          Length = 115

 Score = 45.3 bits (107), Expect = 1e-07
 Identities = 21/108 (19%), Positives = 38/108 (35%), Gaps = 10/108 (9%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
           EA     V  +H +              D   + A+  R     ++     +++  P+  
Sbjct: 18  EAVVAGEVRADHLDLHGTAHGGFLYALADSAFALASNTRGPAVALSC---RMDYFRPLGA 74

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAV 109
           G  +E  A  V + R + T  VEV  E      G+++A     T   +
Sbjct: 75  GARVEARAVEVNLSRRTATYRVEVVSE------GKLVAL-FTGTVFRL 115


>3bnvH [x.x.x] CJ0977
          Length = 128

 Score = 45.0 bits (106), Expect = 1e-07
 Identities = 14/111 (12%), Positives = 32/111 (28%), Gaps = 11/111 (9%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A+++ +   E  +              +      A     +    +      F  P++ 
Sbjct: 27  YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKL 82

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEK 112
           GD+LE+ A  +    +       V           +    G +  V+ +E 
Sbjct: 83  GDVLELEAHALFDETSKKRDVKVVG------HVKEIKFE-GTIQVVSTDEH 126


>3b7jB [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
          Length = 150

 Score = 44.7 bits (105), Expect = 1e-07
 Identities = 11/81 (13%), Positives = 27/81 (33%), Gaps = 7/81 (8%)

Query: 32  VGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFG 91
           +  +       + V  + +  V+F++P+  GD LE    V++       V      +   
Sbjct: 77  LWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIWQVGGTAQVD--- 133

Query: 92  EGNGRVLATQGVLTYVAVNEK 112
                 +  +  L  +    +
Sbjct: 134 ----GKVVAEAELKAMIAERE 150


>1c8uA [d.38.1 - d.38.1] ACYL-COA THIOESTERASE II
          Length = 285

 Score = 44.5 bits (104), Expect = 2e-07
 Identities = 14/113 (12%), Positives = 25/113 (22%), Gaps = 12/113 (10%)

Query: 5   TLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVV------TVAVGSVEFKVP 58
            + +                     D      A +      +           S+ F  P
Sbjct: 178 QVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIATIDHSMWFHRP 237

Query: 59  IRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNE 111
               + L               V  E Y +     +G ++A+  V   V  N 
Sbjct: 238 FNLNEWLLYSVESTSASSARGFVRGEFYTQ-----DGVLVAS-TVQEGVMRNH 284



 Score = 40.3 bits (93), Expect = 3e-06
 Identities = 6/80 (7%), Positives = 11/80 (13%), Gaps = 5/80 (6%)

Query: 9  VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVV 68
                                                 V      F  P  +   +   
Sbjct: 22 RGQSEDLGLRQVFGGQVVGQALYAAKETVPE-----ERLVHSFHSYFLRPGDSKKPIIYD 76

Query: 69 ARVVRVGRTSLTVEVEVYKE 88
             +R G +     V   + 
Sbjct: 77 VETLRDGNSFSARRVAAIQN 96


>3bnvG [x.x.x] CJ0977
          Length = 128

 Score = 44.3 bits (104), Expect = 2e-07
 Identities = 14/112 (12%), Positives = 34/112 (30%), Gaps = 11/112 (9%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
            A+++ +   E  +              +      A     +    +      F  P++ 
Sbjct: 26  YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKL 81

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKG 113
           GD+LE+ A  +    +       V          + +  +G +  V+ +E  
Sbjct: 82  GDVLELEAHALFDETSKKRDVKVVGHV-------KEIKFEGTIQVVSTDEHI 126


>3d6xD [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
          Length = 132

 Score = 44.3 bits (104), Expect = 2e-07
 Identities = 14/99 (14%), Positives = 27/99 (27%), Gaps = 1/99 (1%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARR-AKRPVVTVAVGSVEFKVPI 59
            +  ++      H                   G  A       + V    +   +F+ P+
Sbjct: 33  YKNISISDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESDPKSKVVYFTGIDGAKFRNPV 92

Query: 60  RTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
           R GD L+  + V   G      +  V      E   + +
Sbjct: 93  RPGDRLDYESVVKNRGNWIFKGQAFVDGNLVAEAELKAI 131


>3d6xA [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
          Length = 130

 Score = 44.2 bits (104), Expect = 2e-07
 Identities = 14/92 (15%), Positives = 25/92 (27%)

Query: 7   ELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLE 66
                    P              + G   A     + V    +   +F+ P+R GD L+
Sbjct: 38  ISDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESKSKVVYFTGIDGAKFRNPVRPGDRLD 97

Query: 67  VVARVVRVGRTSLTVEVEVYKERFGEGNGRVL 98
             + V   G      +  V      E   + +
Sbjct: 98  YESVVKNRGNWIFKGQAFVDGNLVAEAELKAI 129


>2b6eB [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
          Length = 136

 Score = 43.8 bits (103), Expect = 3e-07
 Identities = 16/110 (14%), Positives = 33/110 (30%), Gaps = 8/110 (7%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAK-RPVVTVAVGSVEFKVPIR 60
           E           T P             + +GS A +   +    V     +     P+R
Sbjct: 32  EDWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVR 91

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN 110
           +G +    A  + +GR     ++++          ++      LT   +N
Sbjct: 92  SGKVT-ARATPINLGRNIQVWQIDIRT-----EENKLCCV-SRLTLSVIN 134


>2av9H [x.x.x] THIOESTERASE
          Length = 138

 Score = 43.6 bits (102), Expect = 3e-07
 Identities = 18/125 (14%), Positives = 34/125 (27%), Gaps = 13/125 (10%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVE 54
                         +              D   +           +    +  V   S +
Sbjct: 8   YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCD 67

Query: 55  FKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKG 113
           +  P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V     
Sbjct: 68  YFAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSS 121

Query: 114 EPVPV 118
            PV +
Sbjct: 122 RPVAI 126


>3d04B [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
          Length = 149

 Score = 43.6 bits (102), Expect = 3e-07
 Identities = 11/81 (13%), Positives = 26/81 (32%), Gaps = 7/81 (8%)

Query: 29  MDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKE 88
              +  +       + V  + +  V+F++P+  GD LE    V++       V      +
Sbjct: 74  FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIWQVGGTAQVD 133

Query: 89  RFGEGNGRVLATQGVLTYVAV 109
                    +  +  L  +  
Sbjct: 134 -------GKVVAEAELKAMIA 147


>3e29D [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
          Length = 127

 Score = 43.4 bits (102), Expect = 4e-07
 Identities = 16/88 (18%), Positives = 26/88 (29%), Gaps = 4/88 (4%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIR 60
           +            +              +D  G YA A +   PV T     V++     
Sbjct: 30  IVLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTD---HVDYHRVAT 86

Query: 61  TGDLLEVVARVVRVGRTSLTVEVEVYKE 88
            GDL     +V+  G+   T    V  +
Sbjct: 87  PGDLR-AEGQVIHFGKRFATAHARVLDD 113


>3dp3D [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
          Length = 151

 Score = 43.1 bits (101), Expect = 4e-07
 Identities = 11/81 (13%), Positives = 26/81 (32%), Gaps = 7/81 (8%)

Query: 29  MDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKE 88
              +  +       + V  + +  V+F++P+  GD LE    V++       V      +
Sbjct: 76  FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIWQVGGTAQVD 135

Query: 89  RFGEGNGRVLATQGVLTYVAV 109
                    +  +  L  +  
Sbjct: 136 -------GKVVAEAELKAMIA 149


>2cy9B [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
          Length = 124

 Score = 42.7 bits (100), Expect = 6e-07
 Identities = 16/102 (15%), Positives = 37/102 (36%), Gaps = 11/102 (10%)

Query: 7   ELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLE 66
           E V  +HTN             +D + +             V+V       P + G+ + 
Sbjct: 34  EKVEEQHTNKLGTLHGGLTATLVDSISTALCT------EPGVSV-DNITYSPAKIGEEIV 86

Query: 67  VVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVA 108
           + A +++ G+T     V++      +  G+++A      ++ 
Sbjct: 87  ITAHILKQGKTLAFASVDL----TNKTTGKLIAQGRHTKHLG 124


>2av9B [x.x.x] THIOESTERASE
          Length = 138

 Score = 42.0 bits (98), Expect = 9e-07
 Identities = 18/125 (14%), Positives = 34/125 (27%), Gaps = 13/125 (10%)

Query: 1   MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVE 54
                         +              D   +           +    +  V   S +
Sbjct: 7   YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCD 66

Query: 55  FKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKG 113
           +  P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V     
Sbjct: 67  YFAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSS 120

Query: 114 EPVPV 118
            PV +
Sbjct: 121 RPVAI 125


>2av9G [x.x.x] THIOESTERASE
          Length = 135

 Score = 42.0 bits (98), Expect = 1e-06
 Identities = 18/124 (14%), Positives = 34/124 (27%), Gaps = 13/124 (10%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR------RAKRPVVTVAVGSVEF 55
                        +              D   +           +    +  V   S ++
Sbjct: 6   LHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGLDIQGGEVIGLVVSSSCDY 65

Query: 56  KVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVN-EKGE 114
             P+     +E   RV R+G +S+  E+ ++ E   E         G   +V V      
Sbjct: 66  FAPVAFPQRIEG-LRVARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERRSSR 119

Query: 115 PVPV 118
           PV +
Sbjct: 120 PVAI 123


>3b7jC [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
          Length = 150

 Score = 41.6 bits (97), Expect = 1e-06
 Identities = 11/81 (13%), Positives = 25/81 (30%), Gaps = 7/81 (8%)

Query: 29  MDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKE 88
              +  +       + V  + +  V+F++P+  GD LE    V++       V       
Sbjct: 75  FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIWQVGGTAQ-- 132

Query: 89  RFGEGNGRVLATQGVLTYVAV 109
                    +  +  L  +  
Sbjct: 133 -----VDGKVVAEAELKAMIA 148


>3e8pA [x.x.x] UNCHARACTERIZED PROTEIN
          Length = 149

 Score = 41.6 bits (97), Expect = 1e-06
 Identities = 15/116 (12%), Positives = 24/116 (20%), Gaps = 21/116 (18%)

Query: 5   TLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAAR-------------RAKRPVVTVAVG 51
            +                      +D VG   A                 +R      + 
Sbjct: 41  AINKPELIGNIHQQILHGGVTATVLDVVGGLTAFAGLVASRDDWTIEELQQRLQTLGTID 100

Query: 52  SVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYV 107
            V++  P R          V+R G           ++             G  TYV
Sbjct: 101 RVDYLRPGRGQIFT-GTGSVIRAGNRVSVCRELHNEQ-------GTHIAFGTGTYV 148


>2bi0A [x.x.x] HYPOTHETICAL PROTEIN RV0216
          Length = 327

 Score = 40.9 bits (95), Expect = 2e-06
 Identities = 12/93 (12%), Positives = 20/93 (21%), Gaps = 3/93 (3%)

Query: 32  VGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFG 91
           V    +    +R    +    + F      GD L     VV +   S             
Sbjct: 68  VAIGQSTLATQRVKANLFYRGLRFHRFPAVGDTLYTRTEVVGLRANSPKPGRAPTGLAGL 127

Query: 92  EGNGRV---LATQGVLTYVAVNEKGEPVPVEAH 121
                    L        +  +   +P  V   
Sbjct: 128 RTTIDRTDRLVLDFYRCALPASPDWKPGAVPGD 160


>3dozD [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
          Length = 149

 Score = 40.5 bits (94), Expect = 3e-06
 Identities = 14/78 (17%), Positives = 29/78 (37%), Gaps = 7/78 (8%)

Query: 32  VGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFG 91
           +  +       + V  + +  V+F++P+  GD LE    V++       V          
Sbjct: 78  LWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIWQVGGTAQV---- 133

Query: 92  EGNGRVLATQGVLTYVAV 109
             +G+V+A    L  +  
Sbjct: 134 --DGKVVAE-AELKAMIA 148


>3d04F [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
          Length = 148

 Score = 40.1 bits (93), Expect = 4e-06
 Identities = 10/60 (16%), Positives = 22/60 (36%)

Query: 29  MDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKE 88
              +  +       + V  + +  V+F++P+  GD LE    V++       V      +
Sbjct: 73  FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMIWQVGGTAQVD 132


>3e29A [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
          Length = 128

 Score = 38.8 bits (90), Expect = 9e-06
 Identities = 16/87 (18%), Positives = 25/87 (28%), Gaps = 4/87 (4%)

Query: 2   EARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRT 61
                       +              +D  G YA A +   PV T     V++      
Sbjct: 32  VLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTD---HVDYHRVATP 88

Query: 62  GDLLEVVARVVRVGRTSLTVEVEVYKE 88
           GDL     +V+  G+   T    V  +
Sbjct: 89  GDL-RAEGQVIHFGKRFATAHARVLDD 114


>3bbjA [x.x.x] PUTATIVE THIOESTERASE II
          Length = 265

 Score = 37.0 bits (85), Expect = 3e-05
 Identities = 14/78 (17%), Positives = 27/78 (34%), Gaps = 8/78 (10%)

Query: 11 PEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR 70
           +                     + +        +  V+  S  F  P  +G   E+  R
Sbjct: 21 LDPGYLIGTANGGYLTVLQRSALAESD------HLHAVSS-SYHFHRPASSGPA-EIETR 72

Query: 71 VVRVGRTSLTVEVEVYKE 88
          V++ GRT  TV+  +++E
Sbjct: 73 VLKRGRTVTTVQTTLFQE 90


>3bbjB [x.x.x] PUTATIVE THIOESTERASE II
          Length = 262

 Score = 36.7 bits (84), Expect = 4e-05
 Identities = 14/80 (17%), Positives = 27/80 (33%), Gaps = 8/80 (10%)

Query: 9  VFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVV 68
          V  +                     + +        +  V+  S  F  P  +G    + 
Sbjct: 22 VELDPGYLIGTANGGYLTVLQRSALAESD------HLHAVSS-SYHFHRPASSGPAE-IE 73

Query: 69 ARVVRVGRTSLTVEVEVYKE 88
           RV++ GRT  TV+  +++E
Sbjct: 74 TRVLKRGRTVTTVQTTLFQE 93


>2c2iA [x.x.x] RV0130
          Length = 147

 Score = 34.7 bits (79), Expect = 1e-04
 Identities = 8/78 (10%), Positives = 20/78 (25%), Gaps = 2/78 (2%)

Query: 32  VGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVARVVRVGRTSLTVEVEVYKERFG 91
              +    +  +  +   +  V F  P+  G  +   + +V V                 
Sbjct: 70  RLQHQYTVKGVKLAINYGLNKVRFPAPVPVGSRVRATSSLVGVEDLGNGTVQATVSTTVE 129

Query: 92  --EGNGRVLATQGVLTYV 107
                      + ++ YV
Sbjct: 130 VEGSAKPACVAESIVRYV 147


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.322    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0461    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 17,491,065
Number of extensions: 999622
Number of successful extensions: 11983
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5452
Number of HSP's successfully gapped: 326
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)