RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAS81992.1 tthe0 AAS81992.1 GIB00176CH01 "sulfite
dehydrogenase"
         (220 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2biiA [x.x.x] NITRATE REDUCTASE [NADPH]                               115   2e-28
2a9cA [x.x.x] SULFITE OXIDASE                                         104   3e-25
2a9dB [x.x.x] SULFITE OXIDASE                                          98   2e-23
2a9aB [x.x.x] SULFITE OXIDASE                                          93   7e-22
2a9dA [x.x.x] SULFITE OXIDASE                                          88   3e-20
2bihA [x.x.x] NITRATE REDUCTASE [NADPH]                                69   1e-14
2a9aA [x.x.x] SULFITE OXIDASE                                          60   6e-12
2ca3A [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A           55   2e-10
2a9bA [x.x.x] SULFITE OXIDASE                                          55   2e-10
2a99A [x.x.x] SULFITE OXIDASE                                          52   2e-09
2c9xA [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A           36   1e-04

>2biiA [x.x.x] NITRATE REDUCTASE [NADPH]
          Length = 415

 Score =  115 bits (288), Expect = 2e-28
 Identities = 36/225 (16%), Positives = 68/225 (30%), Gaps = 31/225 (13%)

Query: 20  RVPPGQFVT--ERFPILTYGETPKVAK---EAWRLEVTGLVETPLVLTYEDLLAR-PQVE 73
           ++    F+T      +  +G  P V       W + + G+VETP  +   D++ +     
Sbjct: 10  KLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYS 69

Query: 74  LTRDFHCVTRWSRLD------------------VTWKGVRTRDLXXXXXXXXXXXXXXXE 115
                 C     +                      W G    D+               E
Sbjct: 70  TPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWME 129

Query: 116 S-----YGGYTTNXXXXXXXXXXXXX--AHTLFGKPLPPERGGPVRLLVPHLYAWKSAKW 168
                  G Y T                A+   G+ L P+ G P+R+++P +   +S KW
Sbjct: 130 GADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKW 189

Query: 169 VRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRIRFA 213
           ++++V+ D     ++              E  +         R+A
Sbjct: 190 LKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYA 234


>2a9cA [x.x.x] SULFITE OXIDASE
          Length = 359

 Score =  104 bits (259), Expect = 3e-25
 Identities = 42/216 (19%), Positives = 68/216 (31%), Gaps = 37/216 (17%)

Query: 22  PPGQFVTER-------FPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVE 73
           PP + + ER       F    +   P V   ++RL V G     L L+  +L +R P+ E
Sbjct: 12  PPAELLAERFLTPNELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHE 71

Query: 74  LTRDFHCVTRWSRLD------------------VTWKGVRTRDLXXXXXXXXXXXXXXXE 115
           +T    C                            W G R RD+                
Sbjct: 72  VTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHV 131

Query: 116 SY---------GGYTTNXXXXXXXXXXXXX--AHTLFGKPLPPERGGPVRLLVPHLYAWK 164
            +           Y  +               A+ + G  LP + G PVR++VP +   +
Sbjct: 132 CFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGAR 191

Query: 165 SAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERF 200
           S KW+RR+ +        W++  Y         +  
Sbjct: 192 SVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTV 227


>2a9dB [x.x.x] SULFITE OXIDASE
          Length = 359

 Score = 97.9 bits (243), Expect = 2e-23
 Identities = 42/214 (19%), Positives = 69/214 (32%), Gaps = 32/214 (14%)

Query: 19  PRVPPGQFVT--ERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVELT 75
             +   +F+T  E F    +   P V   ++RL V G     L L+  +L +R P+ E+T
Sbjct: 14  AELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGRTLSLSLAELRSRFPKHEVT 73

Query: 76  RDFHCVTRWSRL------------------DVTWKGVRTRDLXXXXXXXXXXXXXXXESY 117
               C                            W G R RD+                 +
Sbjct: 74  ATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCF 133

Query: 118 GG---------YTTN--XXXXXXXXXXXXXAHTLFGKPLPPERGGPVRLLVPHLYAWKSA 166
            G         Y  +               A+ + G  LP + G PVR++VP +   +S 
Sbjct: 134 EGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSV 193

Query: 167 KWVRRIVLLDHLELGFWERLGYHWRGDPWKEERF 200
           KW+RR+ +        W++  Y         +  
Sbjct: 194 KWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTV 227


>2a9aB [x.x.x] SULFITE OXIDASE
          Length = 359

 Score = 93.0 bits (230), Expect = 7e-22
 Identities = 43/226 (19%), Positives = 71/226 (31%), Gaps = 32/226 (14%)

Query: 19  PRVPPGQFVT--ERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVELT 75
             +   +F+T  E F    +   P V   ++RL V G     L L+  +L +R P+ E+T
Sbjct: 14  AELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVT 73

Query: 76  RDFHCVTRWSRLD------------------VTWKGVRTRDLXXXXXXXXXXXXXXXESY 117
               C                            W G R RD+                 +
Sbjct: 74  ATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCF 133

Query: 118 ---------GGYTTN--XXXXXXXXXXXXXAHTLFGKPLPPERGGPVRLLVPHLYAWKSA 166
                      Y  +               A+ + G  LP + G PVR++VP +   +S 
Sbjct: 134 EGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSV 193

Query: 167 KWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRIRF 212
           KW+RR+ +        W++  Y         +       PA +   
Sbjct: 194 KWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELP 239


>2a9dA [x.x.x] SULFITE OXIDASE
          Length = 369

 Score = 87.6 bits (216), Expect = 3e-20
 Identities = 42/215 (19%), Positives = 69/215 (32%), Gaps = 35/215 (16%)

Query: 19  PRVPPGQFVT--ERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVELT 75
             +   +F+T  E F    +   P V   ++RL V G     L L+  +L +R P+ E+T
Sbjct: 27  AELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGP---TLSLSLAELRSRFPKHEVT 83

Query: 76  RDFHCVTRWSRL------------------DVTWKGVRTRDLXXXXXXXXXXXXXXXESY 117
               C                            W G R RD+                 +
Sbjct: 84  ATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCF 143

Query: 118 GG---------YTTNXXXXXXXXXXXXX--AHTLFGKPLPPERGGPVRLLVPHLYAWKSA 166
            G         Y  +               A+ + G  LP + G PVR++VP +   +S 
Sbjct: 144 EGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSV 203

Query: 167 KWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQ 201
           KW+RR+ +        W++  Y         +   
Sbjct: 204 KWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVD 238


>2bihA [x.x.x] NITRATE REDUCTASE [NADPH]
          Length = 453

 Score = 68.8 bits (167), Expect = 1e-14
 Identities = 34/228 (14%), Positives = 64/228 (28%), Gaps = 30/228 (13%)

Query: 15  EGMDPRVPPGQFV-TERFPILTYGETPKVAK---EAWRLEVTGLVETPLVLTYEDLLAR- 69
             +      G         +  +G  P V       W + + G+VETP  +   D++ + 
Sbjct: 44  PPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQF 103

Query: 70  PQVELTRDFHCVTRWSRLD------------------VTWKGVRTRDLXXXXXXXXXXXX 111
                     C     +                      W G    D+            
Sbjct: 104 DIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARF 163

Query: 112 XXXESY-----GGYTTNXXXXXXXXXXXXX--AHTLFGKPLPPERGGPVRLLVPHLYAWK 164
              E       G Y T                A+   G+ L P+ G P+R+++P +   +
Sbjct: 164 VWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGR 223

Query: 165 SAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRIRF 212
           S KW++++V+ D     ++              E  +         R+
Sbjct: 224 SVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERY 271


>2a9aA [x.x.x] SULFITE OXIDASE
          Length = 371

 Score = 60.1 bits (144), Expect = 6e-12
 Identities = 42/211 (19%), Positives = 67/211 (31%), Gaps = 37/211 (17%)

Query: 22  PPGQFVTER-------FPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVE 73
           PP + + ER       F    +   P V   ++RL V G     L L+  +L +R P+ E
Sbjct: 24  PPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHE 83

Query: 74  LTRDFHCVTRWSR------------------LDVTWKGVRTRDLXXXXXXXXXXXXXXXE 115
           +T    C                            W G R RD+                
Sbjct: 84  VTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHV 143

Query: 116 SYGGY-----------TTNXXXXXXXXXXXXXAHTLFGKPLPPERGGPVRLLVPHLYAWK 164
            + G            +               A+ + G  LP + G PVR++VP +   +
Sbjct: 144 CFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGAR 203

Query: 165 SAKWVRRIVLLDHLELGFWERLGYHWRGDPW 195
           S KW+RR+ +        W++  Y       
Sbjct: 204 SVKWLRRVAVSPDESPSHWQQNDYKGFSPCV 234


>2ca3A [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
          Length = 373

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 39/196 (19%), Positives = 62/196 (31%), Gaps = 28/196 (14%)

Query: 20  RVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVELTRDF 78
             P   F          G   ++  +A+RLE+ G V TPL L+ +DL    P  E+    
Sbjct: 46  ITPNDAFFVMYH---LAGIPLEIDPDAFRLEIKGKVGTPLSLSLQDLKNDFPASEVVAVN 102

Query: 79  HCV----------------TRWSRLDVTWKGVRTRDLXXXXXXXXXXXXXXXES------ 116
            C                    +  +  W+GV  + +                       
Sbjct: 103 QCSGNSRGFVEPRVGGGQLANGAMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDGPVI 162

Query: 117 --YGGYTTNXXXXXXXXXXXXXAHTLFGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVL 174
                +                A+++ G  LP   G P+RL+VP  Y     K +  I +
Sbjct: 163 PETPDFVKALSIDHATDGEVMLAYSMNGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITV 222

Query: 175 LDHLELGFWERLGYHW 190
           +D    GFW +  Y  
Sbjct: 223 IDKEFDGFWMKTAYRI 238


>2a9bA [x.x.x] SULFITE OXIDASE
          Length = 372

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 17/67 (25%), Positives = 26/67 (38%), Gaps = 1/67 (1%)

Query: 29  ERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQVELTRDFHCVTRWSRL 87
           E F    +   P V   ++RL V G     L L+  +L +R P+ E+T    C       
Sbjct: 39  ELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSE 98

Query: 88  DVTWKGV 94
               + V
Sbjct: 99  MSRVRPV 105


>2a99A [x.x.x] SULFITE OXIDASE
          Length = 372

 Score = 51.7 bits (122), Expect = 2e-09
 Identities = 17/74 (22%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 14 PEGMDPRVPPGQFVT-ERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLAR-PQ 71
           E     +        E F    +   P V   ++RL V G     L L+  +L +R P+
Sbjct: 23 AEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPK 82

Query: 72 VELTRDFHCVTRWS 85
           E+T    C     
Sbjct: 83 HEVTATLQCAGNRR 96


>2c9xA [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
          Length = 373

 Score = 35.7 bits (80), Expect = 1e-04
 Identities = 21/97 (21%), Positives = 34/97 (35%), Gaps = 20/97 (20%)

Query: 20  RVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLA-RPQVELTRDF 78
             P   F          G   ++  +A+RLE+ G V TPL L+ +DL    P  E+    
Sbjct: 46  ITPNDAFFVRYHLA---GIPLEIDPDAFRLEIKGKVGTPLSLSLQDLKNDFPASEVVAVN 102

Query: 79  HCV----------------TRWSRLDVTWKGVRTRDL 99
            C                    +  +  W+GV  + +
Sbjct: 103 QCSGNSRGFVEPRVGGGQLANGAMGNARWRGVPLKAV 139


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0492    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 14,329,361
Number of extensions: 817440
Number of successful extensions: 9969
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4748
Number of HSP's successfully gapped: 297
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.9 bits)