RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAS82142.1 tthe0 lysR.1 GIB00176CH01 "transcriptional
regulatory protein, lysR family"
         (285 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1bi3A [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             56   1e-10
1c0wA [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             56   2e-10
1b9nA [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)                         50   7e-09
1b9mB [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)                         49   2e-08
1b9nB [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)                         46   1e-07
1b9mA [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)                         44   7e-07
1bi2A [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             42   2e-06
1bi1A [x.x.x] DIPHTHERIA TOXIN REPRESSOR                               41   3e-06
1c0wC [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             38   4e-05
3df8A [x.x.x] POSSIBLE HXLR FAMILY TRANSCRIPTIONAL FACTOR              37   6e-05
1a40A [x.x.x] PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR          37   7e-05
3e6mF [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR                    37   7e-05
1cy0A [e.10.1] DNA TOPOISOMERASE I                                     36   1e-04
3bj6B [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY                   36   1e-04
1biaA [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 / CO...    36   1e-04
3cjnA [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY                   36   1e-04
3e6mB [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR                    36   1e-04
1dtr- [x.x.x] DIPHTHERIA TOXIN REPRESSOR                               36   1e-04
1a54A [c.94.1] PHOSPHATE-BINDING PROTEIN                               35   2e-04
1ddnA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR                        35   2e-04
1bi3B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR                      35   2e-04
2bv6A [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA                  35   2e-04
1cy8A [e.10.1] DNA TOPOISOMERASE I                                     35   3e-04
1c0wB [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             35   3e-04
1bi2B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR                      35   4e-04
3broC [x.x.x] TRANSCRIPTIONAL REGULATOR                                35   4e-04
3echA [x.x.x] MULTIDRUG RESISTANCE OPERON REPRESSOR                    34   5e-04
3broA [x.x.x] TRANSCRIPTIONAL REGULATOR                                34   5e-04
1al3A [x.x.x] CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB               34   5e-04
1dprA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR                        34   6e-04
1cy6A [e.10.1] DNA TOPOISOMERASE I                                     34   6e-04
3e6mE [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR                    34   6e-04
3deuA [x.x.x] TRANSCRIPTIONAL REGULATOR SLYA                           34   7e-04
3bpxA [x.x.x] TRANSCRIPTIONAL REGULATOR                                33   8e-04
3broB [x.x.x] TRANSCRIPTIONAL REGULATOR                                33   8e-04

>1bi3A [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 211

 Score = 56.1 bits (134), Expect = 1e-10
 Identities = 15/181 (8%), Positives = 37/181 (20%), Gaps = 2/181 (1%)

Query: 1   MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGD 60
           M  R +             + AERL  S P ++Q +                 ++TP G 
Sbjct: 7   MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGR 66

Query: 61  XXXXXXXXXXXXXXXXXXXVRRAGQE--ALRFGVPENXXXXXXXXXXXXRRGLGQAVEVL 118
                              +                              + + ++    
Sbjct: 67  TLATAVMRKHRLAERLLTDIIGLDINKVHDEARWEHVMSDEVERRLVKVLKDVSRSPFGN 126

Query: 119 EMHTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRA 178
            +   +++       +D   +  +        E                +   + V +  
Sbjct: 127 PIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVD 186

Query: 179 L 179
            
Sbjct: 187 H 187


>1c0wA [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 173

 Score = 55.8 bits (134), Expect = 2e-10
 Identities = 13/151 (8%), Positives = 30/151 (19%), Gaps = 5/151 (3%)

Query: 1   MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGD 60
           M  R +             + AERL  S P ++Q +                 ++TP G 
Sbjct: 9   MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGR 68

Query: 61  XXXXXXXXXXXXXXXXXXXVRRAGQEA---LRFGVPENXXXXXXXXXXXXRRGLGQAVEV 117
                              +                               + +  +   
Sbjct: 69  TLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDV--SRSP 126

Query: 118 LEMHTPEQVRALKEGRLDYGLAGLKVEDPEV 148
                P         +++        +  ++
Sbjct: 127 FGNPIPGLDELGVIVQINEIFQVETDQFTQL 157


>1b9nA [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
          Length = 258

 Score = 50.2 bits (119), Expect = 7e-09
 Identities = 12/60 (20%), Positives = 18/60 (30%), Gaps = 1/60 (1%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQA-XXXXXXXXXXXXXPFRLTPAG 59
           DPRR+     +A   S  + A+   +S  +    I                   LT  G
Sbjct: 19 ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGAVLTRYG 78


>1b9mB [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
          Length = 244

 Score = 48.9 bits (115), Expect = 2e-08
 Identities = 9/38 (23%), Positives = 15/38 (39%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQA 38
           DPRR+     +A   S  + A+   +S  +    I  
Sbjct: 17 ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINE 54


>1b9nB [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
          Length = 245

 Score = 46.0 bits (108), Expect = 1e-07
 Identities = 24/234 (10%), Positives = 51/234 (21%), Gaps = 10/234 (4%)

Query: 1   MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGD 60
            DPRR+     +A   S  + A+   +S  +    I                 R      
Sbjct: 17  ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVEAVLTRYGQRLI 76

Query: 61  XXXXXXXXXXXXXXXXXXXVRRAGQEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEM 120
                                     +L   +                    Q V+VL  
Sbjct: 77  QLYDLLAQIQQKAFDVLSDDDALPLNSLLAAIS-RFSLQTSARNQWFGTITAQHVDVLLA 135

Query: 121 HTPEQVRALKEGRLD----YGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPL 176
               +++     +             +   +     + +   V    +       + +  
Sbjct: 136 DGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIER 195

Query: 177 RALKEEXXXXXXXXXXXXXYEAFMEVFRRAGFAPKVVREVARFSQAVSLVAAGL 230
            A + E                   V      + +  + V  +  A S++ A L
Sbjct: 196 GAEQCE-----VLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATL 244


>1b9mA [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
          Length = 255

 Score = 43.7 bits (102), Expect = 7e-07
 Identities = 9/37 (24%), Positives = 15/37 (40%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
           DPRR+     +A   S  + A+   +S  +    I 
Sbjct: 17 ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAIN 53


>1bi2A [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 214

 Score = 41.9 bits (97), Expect = 2e-06
 Identities = 16/182 (8%), Positives = 33/182 (18%)

Query: 1   MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGD 60
           M  R +             + AERL  S P ++Q +                 ++TP G 
Sbjct: 8   MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGR 67

Query: 61  XXXXXXXXXXXXXXXXXXXVRRAGQEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEM 120
                              +       +                    + L         
Sbjct: 68  TLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFG 127

Query: 121 HTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALK 180
           +    +  L         A   +       +      +          A         + 
Sbjct: 128 NPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIV 187

Query: 181 EE 182
           + 
Sbjct: 188 DR 189


>1bi1A [x.x.x] DIPHTHERIA TOXIN REPRESSOR
          Length = 212

 Score = 41.5 bits (96), Expect = 3e-06
 Identities = 16/182 (8%), Positives = 32/182 (17%), Gaps = 1/182 (0%)

Query: 1   MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGD 60
           M  R +             + AERL  S P ++Q +                 ++TP G 
Sbjct: 7   MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGR 66

Query: 61  XXXXXXXXXXXXXXXXXXXVRRAGQEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEM 120
                              +       +                   +     +      
Sbjct: 67  TLATAVMRKHRLAERLLTDIIGLDINKVHDEARWEHVMSDEVERRLVKVLKDVSRSPFGN 126

Query: 121 HTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALK 180
             P        G      A   +       +      +          A         + 
Sbjct: 127 PIPGLDELGVPGTRVIDAATS-MPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIV 185

Query: 181 EE 182
           + 
Sbjct: 186 DR 187


>1c0wC [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 175

 Score = 37.9 bits (87), Expect = 4e-05
 Identities = 9/37 (24%), Positives = 14/37 (37%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
          M  R +             + AERL  S P ++Q + 
Sbjct: 9  MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVA 45


>3df8A [x.x.x] POSSIBLE HXLR FAMILY TRANSCRIPTIONAL FACTOR
          Length = 105

 Score = 37.2 bits (86), Expect = 6e-05
 Identities = 4/37 (10%), Positives = 10/37 (27%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
                        +      +    +S   L++RI+
Sbjct: 27 YTLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIK 63


>1a40A [x.x.x] PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
          Length = 321

 Score = 37.0 bits (84), Expect = 7e-05
 Identities = 13/100 (13%), Positives = 35/100 (35%), Gaps = 5/100 (5%)

Query: 85  QEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAGLKVE 144
           + +L                   ++  G  V    + +   V+ +    +D+G +   + 
Sbjct: 1   EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLS 60

Query: 145 DPEVAKE-----PLLRVPIVVALPETHPLAPRARVPLRAL 179
           D ++A+E     P +   +V+A+      +    +  + L
Sbjct: 61  DEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTL 100


>3e6mF [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 145

 Score = 36.9 bits (85), Expect = 7e-05
 Identities = 4/38 (10%), Positives = 12/38 (31%), Gaps = 1/38 (2%)

Query: 1  MDPRRLKAFLVLAEEKSF-HKAAERLYLSQPALTQRIQ 37
          +   +L+    L+            L + Q   ++ + 
Sbjct: 39 LPTPKLRLLSSLSAYGELTVGQLATLGVEQSTTSRTVD 76


>1cy0A [e.10.1] DNA TOPOISOMERASE I
          Length = 534

 Score = 36.5 bits (84), Expect = 1e-04
 Identities = 9/60 (15%), Positives = 16/60 (26%), Gaps = 1/60 (1%)

Query: 1   MDPRR-LKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAG 59
           + P +          E S  K  E+  + +P+    I +              F     G
Sbjct: 426 LTPAQHFTKPPARFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG 485


>3bj6B [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
          Length = 148

 Score = 36.5 bits (84), Expect = 1e-04
 Identities = 2/38 (5%), Positives = 10/38 (26%), Gaps = 1/38 (2%)

Query: 1  MDPRRLKAFLVLAEEKSF-HKAAERLYLSQPALTQRIQ 37
          +   +      L+                +  +++ +Q
Sbjct: 36 VTVGQRAILEGLSLTPGATAPQLGAALQKRQYISRILQ 73


>1biaA [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
          COIL(x) 0]
          Length = 292

 Score = 36.2 bits (83), Expect = 1e-04
 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 2  DPRRLK--AFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
          +   LK  A L   E  S  +  E L +S+ A+ + IQ
Sbjct: 4  NTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQ 41


>3cjnA [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
          Length = 139

 Score = 36.1 bits (83), Expect = 1e-04
 Identities = 5/36 (13%), Positives = 11/36 (30%)

Query: 2  DPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
            +R  A L   +            + Q  L++ + 
Sbjct: 35 TAKRALAILSAKDGLPIGTLGIFAVVEQSTLSRALD 70


>3e6mB [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 146

 Score = 36.1 bits (83), Expect = 1e-04
 Identities = 4/38 (10%), Positives = 12/38 (31%), Gaps = 1/38 (2%)

Query: 1  MDPRRLKAFLVLAEEKSF-HKAAERLYLSQPALTQRIQ 37
          +   +L+    L+            L + Q   ++ + 
Sbjct: 39 LPTPKLRLLSSLSAYGELTVGQLATLGVEQSTTSRTVD 76


>1dtr- [x.x.x] DIPHTHERIA TOXIN REPRESSOR
          Length = 165

 Score = 36.0 bits (82), Expect = 1e-04
 Identities = 9/37 (24%), Positives = 14/37 (37%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
          M  R +             + AERL  S P ++Q + 
Sbjct: 7  MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVA 43


>1a54A [c.94.1] PHOSPHATE-BINDING PROTEIN
          Length = 321

 Score = 35.5 bits (80), Expect = 2e-04
 Identities = 12/100 (12%), Positives = 34/100 (34%), Gaps = 5/100 (5%)

Query: 85  QEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAGLKVE 144
           + +L                   ++  G  V    + +   V+ +    +D+G +   + 
Sbjct: 1   EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLS 60

Query: 145 DPEVA-----KEPLLRVPIVVALPETHPLAPRARVPLRAL 179
           D ++A     + P +   +V+A+      +    +  + L
Sbjct: 61  DEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTL 100


>1ddnA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
          Length = 118

 Score = 35.4 bits (81), Expect = 2e-04
 Identities = 9/37 (24%), Positives = 14/37 (37%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
          M  R +             + AERL  S P ++Q + 
Sbjct: 8  MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVA 44


>1bi3B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 136

 Score = 35.4 bits (81), Expect = 2e-04
 Identities = 12/59 (20%), Positives = 19/59 (32%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAG 59
          M  R +             + AERL  S P ++Q +                 ++TP G
Sbjct: 7  MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTG 65


>2bv6A [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA
          Length = 135

 Score = 35.3 bits (81), Expect = 2e-04
 Identities = 5/39 (12%), Positives = 14/39 (35%), Gaps = 2/39 (5%)

Query: 1  MDPRRLKAFLVLAEEK--SFHKAAERLYLSQPALTQRIQ 37
          +   +     +L +E   +  K    L L    ++  ++
Sbjct: 31 LTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLK 69


>1cy8A [e.10.1] DNA TOPOISOMERASE I
          Length = 563

 Score = 35.0 bits (80), Expect = 3e-04
 Identities = 8/48 (16%), Positives = 13/48 (27%)

Query: 12  LAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAG 59
              E S  K  E+  + +P+    I +              F     G
Sbjct: 444 RFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG 491


>1c0wB [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 219

 Score = 34.9 bits (79), Expect = 3e-04
 Identities = 17/186 (9%), Positives = 35/186 (18%), Gaps = 4/186 (2%)

Query: 1   MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGD 60
           M  R +             + AERL  S P ++Q +                 ++TP G 
Sbjct: 9   MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGR 68

Query: 61  XXXXXXXXXXXXXXXXXXXV---RRAGQEALRFGVPENXXXXXXXXXXXXRRGLGQAVE- 116
                              +                               + + ++   
Sbjct: 69  TLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFG 128

Query: 117 VLEMHTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPL 176
                  E   A     +D   +  +        E                +   + V +
Sbjct: 129 NPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEI 188

Query: 177 RALKEE 182
                 
Sbjct: 189 VDRDGH 194


>1bi2B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 138

 Score = 34.7 bits (79), Expect = 4e-04
 Identities = 11/58 (18%), Positives = 18/58 (31%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPA 58
          M  R +             + AERL  S P ++Q +                 ++TP 
Sbjct: 8  MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT 65


>3broC [x.x.x] TRANSCRIPTIONAL REGULATOR
          Length = 129

 Score = 34.5 bits (79), Expect = 4e-04
 Identities = 3/37 (8%), Positives = 6/37 (16%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
                       +E           +     T  +Q
Sbjct: 28 TQTIIDYLSRNKNKEVLQRDLESEFSIKSSTATVLLQ 64


>3echA [x.x.x] MULTIDRUG RESISTANCE OPERON REPRESSOR
          Length = 129

 Score = 34.1 bits (78), Expect = 5e-04
 Identities = 7/59 (11%), Positives = 18/59 (30%), Gaps = 5/59 (8%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAG 59
          + P  +    ++ E++      +        +T++I+                 LT  G
Sbjct: 35 LTPPDVHVLKLIDEQRGL-NLQDLGRQMCALITRKIRE----LEGRNLVRRQLFLTDEG 88


>3broA [x.x.x] TRANSCRIPTIONAL REGULATOR
          Length = 129

 Score = 34.1 bits (78), Expect = 5e-04
 Identities = 3/37 (8%), Positives = 6/37 (16%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
                       +E           +     T  +Q
Sbjct: 29 TQTIIDYLSRNKNKEVLQRDLESEFSIKSSTATVLLQ 65


>1al3A [x.x.x] CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB
          Length = 237

 Score = 34.1 bits (77), Expect = 5e-04
 Identities = 22/119 (18%), Positives = 40/119 (33%), Gaps = 3/119 (2%)

Query: 115 VEVLEMHTPEQVRALKEGRLDYGLA-GLKVEDPEVAKEPLLRVPIVVALPETHPLAPRAR 173
           + + +    +   A+ +G  D+ +A        ++   P       + +   HPLA +  
Sbjct: 37  LHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGS 96

Query: 174 VPLRALKEEXXXXXXXXXXXXXYEAFMEVFRRAGFAPKVVREVARFSQAVSLVAAGLGV 232
           V +  L +                     F RAG  P++V          + V  GLGV
Sbjct: 97  VSIEELAQY--PLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGV 153


>1dprA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
          Length = 134

 Score = 33.9 bits (77), Expect = 6e-04
 Identities = 9/36 (25%), Positives = 14/36 (38%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRI 36
          M  R +             + AERL  S P ++Q +
Sbjct: 8  MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTV 43


>1cy6A [e.10.1] DNA TOPOISOMERASE I
          Length = 562

 Score = 33.8 bits (77), Expect = 6e-04
 Identities = 9/60 (15%), Positives = 16/60 (26%), Gaps = 1/60 (1%)

Query: 1   MDPRRLKAFLV-LAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAG 59
           + P +          E S  K  E+  + +P+    I +              F     G
Sbjct: 431 LTPAQHFTKPPARFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG 490


>3e6mE [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 146

 Score = 33.8 bits (77), Expect = 6e-04
 Identities = 4/38 (10%), Positives = 12/38 (31%), Gaps = 1/38 (2%)

Query: 1  MDPRRLKAFLVLAEEKSF-HKAAERLYLSQPALTQRIQ 37
          +   +L+    L+            L + Q   ++ + 
Sbjct: 41 LPTPKLRLLSSLSAYGELTVGQLATLGVEQSTTSRTVD 78


>3deuA [x.x.x] TRANSCRIPTIONAL REGULATOR SLYA
          Length = 132

 Score = 33.8 bits (77), Expect = 7e-04
 Identities = 9/59 (15%), Positives = 19/59 (32%), Gaps = 2/59 (3%)

Query: 1  MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAG 59
               L     L  ++S  + A+ + + QP+L + +                 +LT   
Sbjct: 32 THWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQ--LEDKGLISRQKRIKLTEKA 88


>3bpxA [x.x.x] TRANSCRIPTIONAL REGULATOR
          Length = 147

 Score = 33.5 bits (76), Expect = 8e-04
 Identities = 3/40 (7%), Positives = 15/40 (37%), Gaps = 2/40 (5%)

Query: 1  MDPRRLKAFLVLAEEK--SFHKAAERLYLSQPALTQRIQA 38
          +   ++   L +  E      + A   ++ +  + + ++ 
Sbjct: 33 LTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRR 72


>3broB [x.x.x] TRANSCRIPTIONAL REGULATOR
          Length = 133

 Score = 33.4 bits (76), Expect = 8e-04
 Identities = 3/34 (8%), Positives = 6/34 (17%)

Query: 4  RRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQ 37
                    +E           +     T  +Q
Sbjct: 35 IIDYLSRNKNKEVLQRDLESEFSIKSSTATVLLQ 68


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.325    0.141    0.442 

Gapped
Lambda     K      H
   0.267   0.0540    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 25,129,011
Number of extensions: 1579866
Number of successful extensions: 19300
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 9838
Number of HSP's successfully gapped: 474
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)