RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAS80359.1 tthe0 AAS80359.1 GIB00176CH01 "sugar ABC
transporter, periplasmic sugar-binding.."
         (417 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01547 SBP_bac_1 "Bacterial extracellular solute-binding protein"     94   3e-22

>PF01547 SBP_bac_1 "Bacterial extracellular solute-binding protein"
          Length = 282

 Score = 94.4 bits (234), Expect = 3e-22
 Identities = 98/301 (32%), Positives = 139/301 (46%), Gaps = 38/301 (12%)

Query: 44  GGAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIA 103
           G    AA + LV  F K   G  V+ V  G   DL  K+K A AAG  P +     + +A
Sbjct: 1   GDGGDAAAQELVKAFEK-NPGIKVKYVYVGS-GDLLQKLKTALAAGDGPDVVVLDPDWLA 58

Query: 104 LYLEAKALLPIESL------GVRLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLL 157
              +A  L P++ L       +    ++  FL  +   G +YG+P++ +   LYYNKDL 
Sbjct: 59  ELAKAGLLAPLDDLLEKYNPDLDKDALSSDFLPGILDTGKLYGLPYDGTTG-LYYNKDLF 117

Query: 158 KKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNL---GGSYLKDGKLV 214
           KK G+  P T ++ + AAKKL      P  +    + T  YF   L    G + +DG   
Sbjct: 118 KKAGLDPPKTWDDLLDAAKKLKAKGPDPGAYGGDGSGTAGYFLLALLAAAGLFDEDG--- 174

Query: 215 LNSKEAVEALTLLQNGVKEGWAKPITSGYINQN-------LGSGPYAFSVDTSAGYTYYL 267
            NS EAVEAL  L+   K+G A P   G + ++         SG  A  +  S      +
Sbjct: 175 FNSPEAVEALEYLKKLYKKGLAPP---GVLTKDGSEALALFASGEAAMGISGSWAAVALV 231

Query: 268 ---RAAKFDLGVATLPGRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQ 324
                 KFD+GVA LPG + G  G  + +G         SK ++A AK FL+F+LSP   
Sbjct: 232 APKEKPKFDVGVAPLPGGSVGGDGLAIPKG---------SKNKEA-AKKFLDFLLSPEGA 281

Query: 325 A 325
           A
Sbjct: 282 A 282


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0574    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,674,175
Number of extensions: 825458
Number of successful extensions: 99613
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2804
Number of HSP's successfully gapped: 360
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)