RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAS80636.1 tthe0 AAS80636.1 GIB00176CH01
"UDP-N-acetyl-D-mannosamine 6-dehydrogenase"
         (443 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF03721 UDPG_MGDP_dh_N "UDP-glucose/GDP-mannose dehydrogenase fa...    94   3e-22
PF00984 UDPG_MGDP_dh "UDP-glucose/GDP-mannose dehydrogenase fami...    88   3e-20
PF03720 UDPG_MGDP_dh_C "UDP-glucose/GDP-mannose dehydrogenase fa...    43   8e-07
PF02153 PDH "Prephenate dehydrogenase"                                 36   9e-05
PF03446 NAD_binding_2 "NAD binding domain of 6-phosphogluconate ...    35   3e-04

>PF03721 UDPG_MGDP_dh_N "UDP-glucose/GDP-mannose dehydrogenase
           family, NAD binding domain"
          Length = 186

 Score = 94.4 bits (234), Expect = 3e-22
 Identities = 68/167 (40%), Positives = 93/167 (55%), Gaps = 2/167 (1%)

Query: 33  PFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPTE-VLKEVVDKGLLRAETGFDR- 90
           P A   A+ G  VIGV+ +  + E +N GES I +   E +LKE V  G LR  T  +  
Sbjct: 14  PTAACFAEKGHEVIGVDIDEEKVEALNSGESPIYEPGLEELLKENVAAGRLRFTTDLEEA 73

Query: 91  VAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTYPGTTEEVMLP 150
           +A+ DV+ IAVPTP   + +PDL YVE   R IA  L+ G ++ ++ST   GTTEEV+ P
Sbjct: 74  IADADVVFIAVPTPTDEDGSPDLSYVEAAARTIAKVLKKGAIVVIKSTVPVGTTEEVVKP 133

Query: 151 ILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLE 197
           ILE+       DFF+  +PE +  G+  Y   N  +VV G  P   E
Sbjct: 134 ILEELSGLGGVDFFVASNPEFLREGDAVYDLLNPDRVVIGSTPERAE 180


>PF00984 UDPG_MGDP_dh "UDP-glucose/GDP-mannose dehydrogenase family,
           central domain"
          Length = 96

 Score = 87.9 bits (217), Expect = 3e-20
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 1/95 (1%)

Query: 216 AKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKP-FGIMPFYPGPGV 274
           A+ AEL+K+ EN F AVNIA  NELA LC+ +G++VWEV++AA T P  G     PGPGV
Sbjct: 1   ARTAELIKLAENAFLAVNIAFANELANLCEALGIDVWEVIEAAGTDPRIGNHFLNPGPGV 60

Query: 275 GGHCIPIDPHYLEWKAKEYNFNTHFIALAGEINRK 309
           GGHC+P DP  L  KA+E       +     +N +
Sbjct: 61  GGHCLPKDPKALVAKAQELGVPPRLLEAVINVNER 95


>PF03720 UDPG_MGDP_dh_C "UDP-glucose/GDP-mannose dehydrogenase
           family, UDP binding domain"
          Length = 104

 Score = 43.1 bits (101), Expect = 8e-07
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 14/102 (13%)

Query: 336 VLGVAYKRDIPDYRESPAIEVIRGLRRLGAEVEYHDPHVPR---FAEGGLAMESVPLSEE 392
           VLG+A+K +  D RESPA+++I  L   GAEV  +DP V       E    +  V   EE
Sbjct: 2   VLGLAFKPNTDDTRESPALDIIEKLLEEGAEVRIYDPKVKEEEIREELLPGINVVSSLEE 61

Query: 393 RVREKDLVLIATDHSAF---DYK--------AIVAQARRVLD 423
            ++  D ++I T+   F   DY+        A +   R +LD
Sbjct: 62  AIKGADAIVILTEWDEFKNLDYERIYQLMKPAFIFDGRNILD 103


>PF02153 PDH "Prephenate dehydrogenase"
          Length = 255

 Score = 36.2 bits (83), Expect = 9e-05
 Identities = 44/188 (23%), Positives = 82/188 (43%), Gaps = 38/188 (20%)

Query: 71  EVLKEVVDKGLL-RAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRP 129
           E L+  ++ G++  A T  + +A+ D++++AVP   T          E V  E+AP L+P
Sbjct: 19  ESLEAALELGVIDEAATDLEALADADLVILAVPVAAT----------EAVLAELAPHLKP 68

Query: 130 GQLIS-LESTTYP-GTTEEVMLPI------------LEQSGLKVEEDFFLVHSPERVDPG 175
           G +++ + S   P     E +LP              E+SG++  +      +P  + PG
Sbjct: 69  GAIVTDVGSVKAPVVAAAEALLPEDVRFVGGHPMAGPEKSGVEAADADLFEGAPVVLTPG 128

Query: 176 NKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKVVPVSSAKAAELVKVFENTFRAVNIA 235
                         G  P ++E  +  +     +VV +S+ +   +V +  +    +  A
Sbjct: 129 R-------------GTDPEAVERVLELWRALGARVVEMSAEEHDRVVALVSHLPHLLAFA 175

Query: 236 LVNELAML 243
           LVN LA+L
Sbjct: 176 LVNALALL 183


>PF03446 NAD_binding_2 "NAD binding domain of 6-phosphogluconate
           dehydrogenase"
          Length = 160

 Score = 34.7 bits (79), Expect = 3e-04
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 40  KVGFRVIGVEQNPRRAELVNRGESY-IADVPTEVLKEVVDKGLLRAETGFDRVAEMDVIV 98
           K+GF  +GV  +P    L+  G +  + D   E ++ +V +G + A +  + VA  DV++
Sbjct: 3   KIGFIGLGVMGSPMALNLLKAGHTVTVYDRTPEKVEALVAEGAVAAASPAEAVASADVVI 62

Query: 99  IAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTYPGTT 144
             VP             V+ V   + P L  G +I   ST  P  T
Sbjct: 63  TMVPAGAA---------VDAVLFGLLPGLEKGDIIIDGSTISPADT 99


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.320    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0501    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 13,761,659
Number of extensions: 803701
Number of successful extensions: 93017
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2400
Number of HSP's successfully gapped: 222
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)