RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAS81847.1 tthe0 rbsC GIB00176CH01 "ribose transport system
permease protein rbsC"
         (307 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF02653 BPD_transp_2 "Branched-chain amino acid transport system...    42   1e-06

>PF02653 BPD_transp_2 "Branched-chain amino acid transport system /
           permease component"
          Length = 271

 Score = 41.8 bits (98), Expect = 1e-06
 Identities = 40/118 (33%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 151 LVYAAFLLVPLTWWVLFKTPFGLRLRAVGEHPEAADTLGVNVHRMRYXXXXXXXXXXXXX 210
           LV  A +L  L W +L +T FG  LRAVG++ EAA  LG+NV R++              
Sbjct: 137 LVLLALVLALLLWLLLRRTRFGRALRAVGDNEEAARALGINVDRVKLLAFALSGALAGLA 196

Query: 211 XAYLSIGFLNQFVRGMSAGMGFIALAALIFGKWHPV-GILFSTLLFGFASALAIQLQG 267
            A L++  L      M  G+G  A+AA++ G    + G +   LL G    L + L G
Sbjct: 197 GALLAL-RLGSASPSMGFGLGLDAIAAVVLGGLGSILGAVLGALLLGLLENLGLALLG 253


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.327    0.146    0.437 

Gapped
Lambda     K      H
   0.267   0.0585    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 11,776,414
Number of extensions: 663376
Number of successful extensions: 83005
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2063
Number of HSP's successfully gapped: 264
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)