RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAS80359.1 tthe0 AAS80359.1 GIB00176CH01 "sugar ABC
transporter, periplasmic sugar-binding.."
         (417 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1urdA [c.94.1.1] MALTOSE-BINDING PROTEIN                              153   3e-40
1j1nA [c.94.1.1] ALGQ2                                                151   1e-39
1a7lA [c.94.1.1] MALE-B363                                            150   3e-39
1eu8A [c.94.1.1] TREHALOSE/MALTOSE BINDING PROTEIN                    142   9e-37
1eljA [c.94.1.1] MALTODEXTRIN-BINDING PROTEIN                         141   1e-36
1a99A [c.94.1.1] PUTRESCINE-BINDING PROTEIN                           115   7e-29
1potA [c.94.1.1] SPERMIDINE/PUTRESCINE-BINDING PROTEIN                101   1e-24
1y4tA [c.94.1.1] PUTATIVE IRON-UPTAKE ABC TRANSPORT SYSTEM             74   3e-16
1xvxA [c.94.1.1] YFUA                                                  63   8e-13
1pc3A [c.94.1.1] PHOSPHATE-BINDING PROTEIN 1                           60   5e-12
1z21A1 [a.243.1.2] YOP PROTEINS TRANSLOCATION PROTEIN H A:42 -- 145    57   4e-11
1q35A [c.94.1.1] IRON BINDING PROTEIN FBPA                             43   5e-07
2ajfE1 [d.318.1.1] SARS-CORONAVIRUS SPIKE PROTEIN E:323 -- 502         43   8e-07
1d9vA [c.94.1.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)        41   2e-06
1twyA [c.94.1.1] ABC TRANSPORTER, PERIPLASMIC SUBSTRATE-BINDING        36   7e-05
1onwA2 [c.1.9.13] ISOASPARTYL DIPEPTIDASE A:63 -- 346                  35   2e-04
2thiA [c.94.1.1] THIAMINASE I                                          35   2e-04
1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2...    33   7e-04
1eucB2 [d.142.1.4] SUCCINYL-COA SYNTHETASE, BETA CHAIN B:0 -- 245      33   8e-04

>1urdA [c.94.1.1] MALTOSE-BINDING PROTEIN
          Length = 370

 Score =  153 bits (387), Expect = 3e-40
 Identities = 68/380 (17%), Positives = 131/380 (34%), Gaps = 19/380 (5%)

Query: 37  EFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQ 96
             W  +  G     ++ +  ++ KA  G  V  V Q            A   GK P +  
Sbjct: 4   TVWS-WQTGPELQDVKQIAAQWAKAH-GDKVIVVDQSSNPKGFQFYATAARTGKGPDVVF 61

Query: 97  AFENNIALYLEAKALL-PIESLGVRLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKD 155
              ++       + L+ P+ S  +         ++A++  G +Y VP +  +  +YYNK 
Sbjct: 62  GMPHDNNGVFAEEGLMAPVPSGVLNTGLYAPNTIDAIKVNGTMYSVPVSVQVAAIYYNKK 121

Query: 156 LLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFF-FNLGGSYLKDGKLV 214
           L+ +     P T  EFV  A            +F          + F      L    + 
Sbjct: 122 LVPQP----PQTWAEFVKDANAHGFMYDQANLYFDYAIIGGYGGYVFKDNNGTLDPNNIG 177

Query: 215 LNSKEAVEALTLLQNGVKEGW--AKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKF 272
           L++  AV+A TL+++ V +                  +G     V +    T  +  AK 
Sbjct: 178 LDTPGAVQAYTLMRDMVSKYHWMTPSTNGSIAKAEFLAGKIGMYV-SGPWDTADIEKAKI 236

Query: 273 DLGVATLPGRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATG 332
           D GV   P    G+     +      V +++  + QA     ++ + S +AQ ++   + 
Sbjct: 237 DFGVTPWPTLPNGKHATPFLGVITAFVNKES--KTQAADWSLVQALTSAQAQQMYFRDSQ 294

Query: 333 YVPVTEGALKDPVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAIL 392
            +P      +          +P +   V Q RYA   P + + + +        ++  I 
Sbjct: 295 QIPALLSVQRSS----AVQSSPTFKAFVEQLRYAVPMPNIPQMQAV--WQAMSILQNIIA 348

Query: 393 NKADPKAALDRAQKLAEDLL 412
            K  P+       +  +  +
Sbjct: 349 GKVSPEQGAKDFVQNIQKGI 368


>1j1nA [c.94.1.1] ALGQ2
          Length = 492

 Score =  151 bits (382), Expect = 1e-39
 Identities = 36/427 (8%), Positives = 84/427 (19%), Gaps = 44/427 (10%)

Query: 30  ARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAG 89
               +  +    F            V + +       ++ V      +   +     A+G
Sbjct: 7   TDKPLTLKIHMHFRDKWVWDENW-PVAKESFRLTNVKLQSVANKAATNSQEQFNLMMASG 65

Query: 90  KVPAMAQAFENNIALYLEAKA----------LLPIESLGVRLQGVNLTFLNAVRFGGVVY 139
            +P +              +                 +    +             G +Y
Sbjct: 66  DLPDVVGGDNLKDKFIQYGQEGAFVPLNKLIDQYAPHIKAFFKSHPEVERAIKAPDGNIY 125

Query: 140 GVPFN---KSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPV---------- 186
            +P+       +  +  +D LKK  +  P  ++E     K     +              
Sbjct: 126 FIPYVPDGVVARGYFIREDWLKKLNLKPPQNIDELYTVLKAFKEKDPNGNGKADEVPFID 185

Query: 187 --------YWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKP 238
                         A +     +          K         + +  +    KEG    
Sbjct: 186 RHPDEVFRLVNFWGARSSGSDNYMDFYIDNGRVKHPWAETAFRDGMKHVAQWYKEGLIDK 245

Query: 239 ITSGY----INQNLGSGPYAFSVDTSAGYTYYLRAAK---FDLGVATLPGRTKGQPGYGL 291
                      Q  G     F+ D  A    +            +  +   T  +     
Sbjct: 246 EIFTRKAKAREQMFGGNLGGFTHDWFASTMTFNEGLAKTVPGFKLIPIAPPTNSKGQRWE 305

Query: 292 VQGTNLVVFRQASK----EEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQ 347
                 V     +     +       F +F  S   + +       V       K     
Sbjct: 306 EDSRQKVRPDGWAITVKNKNPVETIKFFDFYFSRPGRDISNFGVPGVTYDIKNGKAVFKD 365

Query: 348 AYAAENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKL 407
           +           +             +++  R        +  I      K  +   + +
Sbjct: 366 SVLKSPQPVNNQLYDMGAQIPIGFWQDYDYER-QWTTPEAQAGIDMYVKGKYVMPGFEGV 424

Query: 408 AEDLLSS 414
                  
Sbjct: 425 NMTREER 431


>1a7lA [c.94.1.1] MALE-B363
          Length = 380

 Score =  150 bits (379), Expect = 3e-39
 Identities = 68/388 (17%), Positives = 115/388 (29%), Gaps = 27/388 (6%)

Query: 33  KVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVP 92
           +     W    G      L  +  +F K   G  V          L  K     A G  P
Sbjct: 1   EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVEH---PDKLEEKFPQVAATGDGP 54

Query: 93  AMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYY 152
            +     +    Y ++  L  I         +     +AVR+ G +   P       L Y
Sbjct: 55  DIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY 114

Query: 153 NKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGG------- 205
           NKDLL       P T EE  A  K+L       + +   +           GG       
Sbjct: 115 NKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYEN 170

Query: 206 SYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKPITSG-YINQNLGSGPYAFSVDTSAGYT 264
                  + +++  A   LT L + +K       T           G  A +++      
Sbjct: 171 GKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGP-WAW 229

Query: 265 YYLRAAKFDLGVATLPGRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQ 324
             +  +K + GV  LP   KGQP    V   +  +   +    + +AK+FLE  L     
Sbjct: 230 SNIDTSKVNYGVTVLPT-FKGQPSKPFVGVLSAGINAAS--PNKELAKEFLENYLLTDEG 286

Query: 325 AVFATATGYVPVTEGALKDPVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQIRFDILG 384
                    +        +       A++P  A  +  ++  +  P + +        + 
Sbjct: 287 LEAVNKDKPLGAVALKSYEE----ELAKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVR 341

Query: 385 QAIKEAILNKADPKAALDRAQKLAEDLL 412
            A+  A   +     AL    +      
Sbjct: 342 TAVINAASGRQTVDEALKDGSQDPRVRG 369


>1eu8A [c.94.1.1] TREHALOSE/MALTOSE BINDING PROTEIN
          Length = 407

 Score =  142 bits (357), Expect = 9e-37
 Identities = 81/410 (19%), Positives = 147/410 (35%), Gaps = 37/410 (9%)

Query: 33  KVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVR--PVPQGGYRDLSTKIKAAFAAGK 90
           +    F             + ++ EF K   G  V          +     + A      
Sbjct: 3   EGKIVFAV-GGAPNEIEYWKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSS 61

Query: 91  VPAMAQAFENNIALYLEAKALLPIESLGVR-----LQGVNLTFLNAVRFGGVVYGVPFNK 145
            P +       +  ++ +  L P++    +               A + GG +Y +P   
Sbjct: 62  DPDVFLMDVAWLGQFIASGWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYI 121

Query: 146 SIQVLYYNKDLLKKHGVP-VPATLEEFVAAAKKLSRAEGGPVY----------WFQPDAS 194
              +LYY KDLL+K+G    P T +E V  A+K+   E                ++    
Sbjct: 122 DAGLLYYRKDLLEKYGYSKPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVC 181

Query: 195 TFAYFFFNLGGSY----LKDGKLVLNSKEAVEALTLLQNGVKEGWAKPI------TSGYI 244
            F  + ++ GGS            LN  E VEAL  + + + +    P       T   +
Sbjct: 182 DFVEYVYSNGGSLGEFKDGKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPV 241

Query: 245 NQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPGRTK--GQPGYGLVQGTNLVVFRQ 302
                 G  AF  +    +  +        G   +       G      + G ++ + + 
Sbjct: 242 RLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKY 301

Query: 303 ASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYAAENPDYATIVRQ 362
           +  + +A+A +F++FV S   Q  FA   G+ P       DP   A  +++P    +   
Sbjct: 302 S--DNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDP---AVVSKSPHLKELRAV 356

Query: 363 SRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLL 412
              A   P +  + Q+  +I+ + +  A+  K  P+ ALD+AQK AE+L+
Sbjct: 357 FENAVPRPIVPYYPQL-SEIIQKYVNSALAGKISPQEALDKAQKEAEELV 405


>1eljA [c.94.1.1] MALTODEXTRIN-BINDING PROTEIN
          Length = 380

 Score =  141 bits (356), Expect = 1e-36
 Identities = 59/393 (15%), Positives = 114/393 (29%), Gaps = 25/393 (6%)

Query: 30  ARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAG 89
              +     WH           ++L  E+        +    +         +KAA   G
Sbjct: 2   KIEEGKVVIWH-AMQPNELEVFQSLAEEYMALXPEVEIVFEQKPNL---EDALKAAIPTG 57

Query: 90  KVPAMAQAFENNIALYLEAKALLPIESL--GVRLQGVNLTFLNAVRFGGVVYGVPFNKSI 147
           + P +     + I  + EA  L PI+       L        +A+++ G  Y +PF    
Sbjct: 58  QGPDLFIWAHDWIGKFAEAGLLEPIDEYVTEDLLNEFAPMAQDAMQYKGHYYALPFAAET 117

Query: 148 QVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSY 207
             + YNK+++ +     P T +E  A  +K             P  + F        G Y
Sbjct: 118 VAIIYNKEMVSEP----PKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGY 173

Query: 208 L---KDGKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYT 264
               K  +  L+  E +E        +    A              G     V+      
Sbjct: 174 YFDDKTEQPGLDKPETIEGFKFFFTEIWPYMAPTGDYNTQQSIFLEGRAPMMVN-GPWSI 232

Query: 265 YYLRAAKFDLGVATLP---GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSP 321
             ++ A  + GV  LP      K            +        + +  A  F +++ + 
Sbjct: 233 NDVKKAGINFGVVPLPPIIKDGKEYWPRPYGGVKLIYFAAGI--KNKDAAWKFAKWLTTS 290

Query: 322 RAQAVFATATGYVPVTEGALKDPVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQIRFD 381
                              + D         +P      +  ++A   P   +   +   
Sbjct: 291 EESIKTLALELGYIPVLTKVLDD---PEIKNDPVIYGFGQAVQHAYLMPKSPKMSAVW-G 346

Query: 382 ILGQAIKEAILNK--ADPKAALDRAQKLAEDLL 412
            +  AI E + +   AD +  L + Q+   + +
Sbjct: 347 GVDGAINEILQDPQNADIEGILKKYQQEILNNM 379


>1a99A [c.94.1.1] PUTRESCINE-BINDING PROTEIN
          Length = 341

 Score =  115 bits (289), Expect = 7e-29
 Identities = 42/349 (12%), Positives = 75/349 (21%), Gaps = 22/349 (6%)

Query: 45  GAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIAL 104
                   + V  F K + G  V                   A      +     + +  
Sbjct: 8   NWSDYIAPDTVANFEK-ETGIKVVYDVFDSN---EVLEGKLMAGSTGFDLVVPSASFLER 63

Query: 105 YLEAKALLPIESL---GVRLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHG 161
            L A    P++       +     L  L A       + +P+  +   + YN D +K   
Sbjct: 64  QLTAGVFQPLDKSKLPEWKNLDPELLKLVAKHDPDNKFAMPYMWATTGIGYNVDKVKAVL 123

Query: 162 VPV--PATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKE 219
                  + +  +           G  +              N  G              
Sbjct: 124 GENAPVDSWDLILKPENLEKLKSCGVSFL--DAPEEVFATVLNYLGKDPNST---KADDY 178

Query: 220 AVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATL 279
              A  LL             S     +L +G    ++  +         AK       +
Sbjct: 179 TGPATDLLLKLRPNIRYF--HSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNV 236

Query: 280 PGRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEG 339
                 +            +   A  + +  A  FL ++L P   A  +    Y    + 
Sbjct: 237 SFSIPKEGAM--AFFDVFAMPADA--KNKDEAYQFLNYLLRPDVVAHISDHVFYANANKA 292

Query: 340 ALKDPVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIK 388
           A       A   ENP                                +K
Sbjct: 293 ATPLV--SAEVRENPGIYPPADVRAKLFTLKVQDPKIDRVRTRAWTKVK 339


>1potA [c.94.1.1] SPERMIDINE/PUTRESCINE-BINDING PROTEIN
          Length = 322

 Score =  101 bits (252), Expect = 1e-24
 Identities = 46/347 (13%), Positives = 87/347 (25%), Gaps = 33/347 (9%)

Query: 45  GAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIAL 104
              +     L+ +F K   G  V          +  K+K          +       +  
Sbjct: 8   NWTEYVPPGLLEQFTKET-GIKVIYSTYESNETMYAKLKTY--KDGAYDLVVPSTYYVDK 64

Query: 105 YLEAKALLPIESLGVR-LQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVP 163
             +   +  I+   +     ++   LN        Y +P+      +  N D +      
Sbjct: 65  MRKEGMIQKIDKSKLTNFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKS-- 122

Query: 164 VPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEA 223
              +  +      K      G +         F      LG S         + KE   A
Sbjct: 123 -VTSWADLWKPEYK------GSLLLTDDAREVFQMALRKLGYSGNT-----TDPKEIEAA 170

Query: 224 LTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPGRT 283
              L+  +    A    S         G     +    G  +  R A   + V       
Sbjct: 171 YNELKKLMPNVAA--FNSDNPANPYMEGEVNLGM-IWNGSAFVARQAGTPIDVVWPKEGG 227

Query: 284 KGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKD 343
                  +    +L +   A  +E A     + F+L P      A   GY      A K 
Sbjct: 228 -------IFWMDSLAIPANAKNKEGA--LKLINFLLRPDVAKQVAETIGYPTPNLAARKL 278

Query: 344 PVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEA 390
                  A +          +  +++  +       ++   Q +K  
Sbjct: 279 L--SPEVANDKTLYPDAETIKNGEWQNDVGAASS-IYEEYYQKLKAG 322


>1y4tA [c.94.1.1] PUTATIVE IRON-UPTAKE ABC TRANSPORT SYSTEM
          Length = 317

 Score = 74.3 bits (181), Expect = 3e-16
 Identities = 42/335 (12%), Positives = 95/335 (28%), Gaps = 29/335 (8%)

Query: 45  GAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIAL 104
                A   ++ +F + + G  V         +L  ++    +         A  +N+  
Sbjct: 8   ARHYNADFEIIKKFEE-KTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFITADISNLTE 65

Query: 105 YLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVPV 164
                 L P+ S  +        F+ A             K  +++ YNK+      +  
Sbjct: 66  AKNLGLLSPVSSKYLE------EFIPAHLRDKDKEWFAITKRARIIAYNKNTNI--DISK 117

Query: 165 PATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEAL 224
               E+   A  K      G +      A        ++  +          +KEA    
Sbjct: 118 MKNYEDLAKAEFK------GEIVMRSATAPYSKTLLASIIAND--------GNKEAKAWA 163

Query: 225 TLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAK-FDLGVATLPGRT 283
             +   +                 G   +A       G     +  K  ++G +      
Sbjct: 164 KGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFP 223

Query: 284 KGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKD 343
                   +  + + + + +  ++ A  K F+EF+LSP  Q +   +    P+       
Sbjct: 224 NQDNRGTHINISGIAMTKSSKNQDAA--KKFMEFMLSPEIQKILTDSNYEFPIRNDVELS 281

Query: 344 PVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQI 378
              + +     D   I         + A+  ++++
Sbjct: 282 QTVKDFGTFKED--QIPVSKIAENIKEAVKIYDEV 314


>1xvxA [c.94.1.1] YFUA
          Length = 311

 Score = 62.7 bits (151), Expect = 8e-13
 Identities = 36/317 (11%), Positives = 79/317 (24%), Gaps = 36/317 (11%)

Query: 45  GAPKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIAL 104
              +  +++ V  F K    +    +  GG  +L  ++    +A             + L
Sbjct: 11  AQHENLVKSWVDGFTKDTGIKVT--LRNGGDSELGNQLVQEGSASPADVFLTENSPAMVL 68

Query: 105 YLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVPV 164
              AK   P+++       V    +                   V  YN + + +  +P 
Sbjct: 69  VDNAKLFAPLDA-------VTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAELP- 120

Query: 165 PATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEAL 224
             ++ +      K         +   P  + F      +              K  +E L
Sbjct: 121 -KSIMDLAKPEWKGR-------WAASPSGADFQAIVSAMLELK--------GEKATLEWL 164

Query: 225 TLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYL-RAAKFDLGVATLPGRT 283
             ++               +N   G                           +     + 
Sbjct: 165 KAMKTNFTAYKGNSTVMKAVNA--GQIDGGVIYHYYRFVDQAKTGENSGKTQLHYFKHQD 222

Query: 284 KGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGY-VPVTEGALK 342
            G      V  +   V   AS +    A++F++++     Q +  T   +   V   A  
Sbjct: 223 PGAF----VSISGGGVL--ASSKHPKEAQEFVKWITGKSGQDILRTNNAFEYAVGVDAAS 276

Query: 343 DPVYQAYAAENPDYATI 359
           +P        +      
Sbjct: 277 NPKLVPLKDLDAPKVEP 293


>1pc3A [c.94.1.1] PHOSPHATE-BINDING PROTEIN 1
          Length = 333

 Score = 60.0 bits (144), Expect = 5e-12
 Identities = 23/214 (10%), Positives = 50/214 (23%), Gaps = 10/214 (4%)

Query: 139 YGVPFNKSIQVLYYNKDLLKKHGVPVP-ATLEEFVAAAKKLSRAEGGPVYWFQPDASTFA 197
               +  +I+     +      GV +P   +     +               Q       
Sbjct: 109 LAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGK 168

Query: 198 YFFFN--LGGSYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAF 255
              F   +    +        +   V         V       +          +     
Sbjct: 169 SPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNS 228

Query: 256 SVDTSAGYTYYLRAA------KFDLGVATLPGRTKGQPGYGLVQGTNLVVFRQASKEEQA 309
           S +        ++AA      K     A          GY ++     +V  +      A
Sbjct: 229 SGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATA 288

Query: 310 -VAKDFLEFVLSPRAQAVFATATGYVPVTEGALK 342
              + FL + ++   +A F     + P+    +K
Sbjct: 289 QTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVK 322


>1z21A1 [a.243.1.2] YOP PROTEINS TRANSLOCATION PROTEIN H A:42 -- 145
          Length = 96

 Score = 56.9 bits (137), Expect = 4e-11
 Identities = 11/85 (12%), Positives = 23/85 (27%)

Query: 294 GTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYAAEN 353
                V  Q            LE + +P  +A+ A    +      A+  P  ++   + 
Sbjct: 3   EKTREVLWQQYYASNPPDHAVLEVLATPVREALLARFGQHQGSVVPAIDLPELRSVLQQF 62

Query: 354 PDYATIVRQSRYAKFEPALAEWEQI 378
             +            E  L    ++
Sbjct: 63  DSFGKRWEAILLQVLEGILPYLSEL 87


>1q35A [c.94.1.1] IRON BINDING PROTEIN FBPA
          Length = 317

 Score = 43.3 bits (102), Expect = 5e-07
 Identities = 46/240 (19%), Positives = 79/240 (32%), Gaps = 36/240 (15%)

Query: 149 VLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYL 208
           V+Y +KD + K  +P      +      K      G V       S     F  +   Y 
Sbjct: 103 VIYTSKDRVGK--LPAGFDYLDLAKPEYK------GKVCVRSGKNSYNVSLFAAMIEHYG 154

Query: 209 KDGKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLR 268
            +           +    L+ G+K   A+    G  +Q           D S G +YY  
Sbjct: 155 IE-----------KTKAFLE-GLKANLARKPQGGDRDQVKAIK--EGICDYSIGNSYYYG 200

Query: 269 AAKFD-----LGVATLPGRTKGQPGYGL-VQGTNLVVFRQASKEEQAVAKDFLEFVLSPR 322
               D        A +     G+ G    + G  +          +A A   +E++   +
Sbjct: 201 KMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIA----KHSPNKANAVKLIEYLSGEK 256

Query: 323 AQAVFATATGYVPVTEGALKDPVYQAYAAENPDYATIVRQSRYAK-FEPALAEWEQIRFD 381
           AQ ++A      PV EG     + + +     D   +      AK +E AL   ++++FD
Sbjct: 257 AQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKL---EDIAKNYEAALKLVDEVKFD 313


>2ajfE1 [d.318.1.1] SARS-CORONAVIRUS SPIKE PROTEIN E:323 -- 502
          Length = 174

 Score = 42.7 bits (100), Expect = 8e-07
 Identities = 12/117 (10%), Positives = 23/117 (19%), Gaps = 12/117 (10%)

Query: 52  ENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENN-IALYLEAKA 110
            + V +    Q G       +     +   +       +          N    YL    
Sbjct: 63  GDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWN---TRNIDATSTGNYNYKYRYLRHGK 119

Query: 111 LLPIESLGVRLQGV-----NLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGV 162
           L P E     +                 +    YG     +   + Y    +     
Sbjct: 120 LRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFY---TTTGIGYQPYRVVVLSF 173


>1d9vA [c.94.1.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)
          Length = 309

 Score = 41.5 bits (97), Expect = 2e-06
 Identities = 35/227 (15%), Positives = 68/227 (29%), Gaps = 26/227 (11%)

Query: 130 NAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWF 189
             V        +  +   +V+ Y+   L +    +  ++ ++     K      G +   
Sbjct: 85  KGVPLAPKKDWIALSGRSRVVVYDHTKLSEK--DMEKSVLDYATPKWK------GKI--- 133

Query: 190 QPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQ-NL 248
               ST   F   +       G      K A+  L  L+   K        S  +     
Sbjct: 134 -GYVSTSGAFLEQVVALSKMKGD-----KVALNWLKGLKENGK---LYAKNSVALQAVEN 184

Query: 249 GSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPGRTKGQPGYGLVQGTNLVVFRQASKEEQ 308
           G  P A   +    Y Y L   K    + +     + Q    LV  +   V + +  + +
Sbjct: 185 GEVPAALINN---YYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAE 241

Query: 309 AVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYAAENPD 355
           A  + F++F+ S + Q     A    P+    +     + Y      
Sbjct: 242 A--QKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAP 286


>1twyA [c.94.1.1] ABC TRANSPORTER, PERIPLASMIC SUBSTRATE-BINDING
          Length = 249

 Score = 36.3 bits (82), Expect = 7e-05
 Identities = 21/152 (13%), Positives = 45/152 (29%), Gaps = 18/152 (11%)

Query: 183 GGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKPITSG 242
              +     +AS+   + F          K V + + +  A T L           +   
Sbjct: 114 DQKIAVVTREASSGTRYSFES---LXGLTKTVKDREVSDVAPTALVVNSNSXXKTLVNHN 170

Query: 243 YINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPGRTKGQPGYGLVQGTNLVVFRQ 302
                      A    +       ++A +F+    T       +  Y L +   ++ +  
Sbjct: 171 ---------TQAVGFISIGSVDKSVKAIQFEKADPTSD--NIAKHTYQLSRPFLILHYS- 218

Query: 303 ASKEEQAVAKDFLEFVLSPRAQAVFATATGYV 334
                    K+F+ F+ S  A+ +     GY+
Sbjct: 219 --DNADEQTKEFIAFLKSESAKKLIVEY-GYI 247


>1onwA2 [c.1.9.13] ISOASPARTYL DIPEPTIDASE A:63 -- 346
          Length = 271

 Score = 34.8 bits (80), Expect = 2e-04
 Identities = 18/89 (20%), Positives = 37/89 (41%), Gaps = 6/89 (6%)

Query: 65  RCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGV 124
           + +    +GG  D+++ I    A  +   +A+A +  I L   A+  L  +  G  + G 
Sbjct: 178 QALEFARKGGTIDITSSIDEPVAPAE--GIARAVQAGIPL---ARVTLSSDGNGSGVAGF 232

Query: 125 NLTFLNAVRFGGVVYGVPFNKSIQVLYYN 153
             T L  V+     Y    + +++ L  +
Sbjct: 233 E-TLLETVQVLVKDYDFSISDALRPLTSS 260


>2thiA [c.94.1.1] THIAMINASE I
          Length = 362

 Score = 34.6 bits (79), Expect = 2e-04
 Identities = 13/42 (30%), Positives = 18/42 (42%)

Query: 129 LNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVPVPATLEE 170
           L   +  G VYG+P      +L+Y K  LK   V     L +
Sbjct: 88  LQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYK 129


>1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
           A:113 -- 318
          Length = 204

 Score = 32.9 bits (74), Expect = 7e-04
 Identities = 5/40 (12%), Positives = 10/40 (25%), Gaps = 9/40 (22%)

Query: 154 KDLLKKHGVPVPAT-----LEEFVAAAKKLSRAEGGPVYW 188
           +   ++  +P            F  A   +    G P   
Sbjct: 7   RLAAEELQLPTSTYRFADSESLFREAVADI----GYPCIV 42


>1eucB2 [d.142.1.4] SUCCINYL-COA SYNTHETASE, BETA CHAIN B:0 -- 245
          Length = 246

 Score = 32.8 bits (75), Expect = 8e-04
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 5/34 (14%)

Query: 151 YYNKDLLKKHGVPVPA-----TLEEFVAAAKKLS 179
           Y +K L+  +GV V       T  E + AAK+L+
Sbjct: 7   YQSKKLMSDNGVKVQRFFVADTANEALEAAKRLN 40


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0636    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 13,204,021
Number of extensions: 913723
Number of successful extensions: 3877
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 3795
Number of HSP's successfully gapped: 90
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)