RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAS80675.1 tthe0 AAS80675.1 GIB00176CH01 "glucose transport
system permease protein"
         (369 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG...    62   9e-13
2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF...    58   1e-11
1tluA [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,        50   5e-09
3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN...    45   1e-07
2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE ...    44   3e-07

>2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
           G:7 -- 296
          Length = 284

 Score = 62.2 bits (151), Expect = 9e-13
 Identities = 26/130 (20%), Positives = 41/130 (31%), Gaps = 1/130 (0%)

Query: 208 LLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEA 267
            +L   A       L         L   G ++ A        +         I   + EA
Sbjct: 121 AVLSLVALYALFDRLGEYI-PFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEA 179

Query: 268 ARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAIYM 327
           A +DGA+ WQ FR V+ P+  PI     I+    A+    +   +     + T    +  
Sbjct: 180 AALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQ 239

Query: 328 YLLAFRGNQF 337
           YL        
Sbjct: 240 YLNPQNYLWG 249


>2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
           F:261 -- 504
          Length = 244

 Score = 58.5 bits (141), Expect = 1e-11
 Identities = 30/136 (22%), Positives = 48/136 (35%), Gaps = 9/136 (6%)

Query: 210 LWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAAR 269
                    L  +        + A   +I+   W    Y M L +  L+ IP ++ EA+ 
Sbjct: 85  GEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASA 144

Query: 270 VDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLD---------YAPT 320
           +DGA  +Q F ++  P+L       MI         F L+  +                T
Sbjct: 145 MDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYT 204

Query: 321 DVPAIYMYLLAFRGNQ 336
           D+   Y Y +AF G  
Sbjct: 205 DLLVNYTYRIAFEGGG 220


>1tluA [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
          Length = 117

 Score = 50.0 bits (119), Expect = 5e-09
 Identities = 11/105 (10%), Positives = 23/105 (21%), Gaps = 4/105 (3%)

Query: 237 VILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMI 296
            +   +           L  ++ I  E+ +AA   GA+          P      +    
Sbjct: 2   SLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVISE 61

Query: 297 VLGHIALK---IFDLVFAMAGLDYA-PTDVPAIYMYLLAFRGNQF 337
               I       +  +      +   P          L  +    
Sbjct: 62  SHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHV 106


>3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
           A:6 -- 208
          Length = 203

 Score = 45.0 bits (106), Expect = 1e-07
 Identities = 18/68 (26%), Positives = 32/68 (47%)

Query: 229 GFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLA 288
           G S+ L   I+      + +   +    L  IP  ++EA+R  GA+  Q+ R+V+ P   
Sbjct: 79  GTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEAL 138

Query: 289 PITLSAMI 296
           P  ++A  
Sbjct: 139 PGLVNAAT 146


>2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
           -- 252
          Length = 252

 Score = 43.9 bits (103), Expect = 3e-07
 Identities = 20/126 (15%), Positives = 40/126 (31%)

Query: 207 VLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLE 266
           V  +          L+       F  AL G+++A ++      +     G   + V +  
Sbjct: 101 VAGIALLVVFGSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEH 160

Query: 267 AARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAIY 326
            AR  G+S  ++F  V  P+     ++  I+     +  F  V  +A        +    
Sbjct: 161 VARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYER 220

Query: 327 MYLLAF 332
                 
Sbjct: 221 YLSEGL 226


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.331    0.146    0.467 

Gapped
Lambda     K      H
   0.267   0.0450    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 13,725,304
Number of extensions: 967929
Number of successful extensions: 5828
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 5251
Number of HSP's successfully gapped: 671
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)