RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAS81311.1 tthe0 livG.4 GIB00176CH01 "branched-chain amino acid
transport ATP-binding .."
         (259 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ji0A [c.37.1.12] ABC TRANSPORTER                                     145   6e-38
1b0uA [c.37.1.12] HISTIDINE PERMEASE                                  137   1e-35
1sgwA [c.37.1.12] PUTATIVE ABC TRANSPORTER                            118   7e-30
1l7vC [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD      112   6e-28
1q3hA [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE           109   4e-27
1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564     96   5e-23
1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERAS...    95   7e-23
1e69A [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN                   89   5e-21
1g6hA [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID              88   2e-20
1e9rA [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB                       84   2e-19
1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379          83   3e-19
1ex6A [c.37.1.1] GUANYLATE KINASE                                      83   3e-19
1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223                81   1e-18
2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373                     80   3e-18
1urjA [e.58.1.1] MAJOR DNA-BINDING PROTEIN                             74   2e-16
1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278                              74   2e-16
1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:...    72   7e-16
1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC A...    72   7e-16
1mukA [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3                            72   7e-16
1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --...    72   8e-16
1kgdA [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK                       72   9e-16
1t06A [a.118.1.17] HYPOTHETICAL PROTEIN                                71   2e-15
2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489                     71   2e-15
1i1qA [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I                    70   2e-15
1vplA [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN                 70   3e-15
1ffhA2 [c.37.1.10] FFH A:89 -- 295                                     70   4e-15
1udwA [c.37.1.6] URIDINE-CYTIDINE KINASE 2                             68   1e-14
1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173                       68   1e-14
1mjgM [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT           65   1e-13
1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150             64   2e-13
1jjvA [c.37.1.1] DEPHOSPHO-COA KINASE                                  64   2e-13
1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397            64   2e-13
1mi8A [b.86.1.2] DNAB INTEIN                                           64   2e-13
2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251          61   1e-12
2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225              61   2e-12
2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494       60   2e-12
1n25A [c.37.1.20] LARGE T ANTIGEN                                      60   3e-12
1ckvA [d.137.1.1] PROTEIN (PROTEIN B)                                  60   3e-12
1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200                            60   4e-12
1l7lA [b.18.1.16] PA-I GALACTOPHILIC LECTIN                            60   4e-12
1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800       59   7e-12
1fl9A [c.37.1.18] HYPOTHETICAL PROTEIN HI0065                          58   1e-11
1qhlA [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)                 57   3e-11
1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480                 56   4e-11
1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180           55   1e-10
1mm8A [c.55.3.4] TN5 TRANSPOSASE                                       53   5e-10
1afrA [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE       53   5e-10
1g6oA [c.37.1.11] CAG-ALPHA                                            52   6e-10
1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244                  52   6e-10
1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188          52   7e-10
1cd5A [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)          52   8e-10
1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173            52   9e-10
1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181             52   1e-09
1cr0A [c.37.1.11] DNA PRIMASE/HELICASE                                 51   1e-09
1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177...    51   1e-09
2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --...    50   3e-09
1g8yA [c.37.1.11] REGULATORY PROTEIN REPA                              50   3e-09
1tmkA [c.37.1.1] THYMIDYLATE KINASE                                    50   3e-09
1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366         50   3e-09
1grqA [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE                50   4e-09
1em8A [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT                       49   5e-09
1e6cA [c.37.1.2] SHIKIMATE KINASE                                      49   5e-09
2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206                          49   6e-09
1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306                 49   6e-09
1d6jA [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE                     49   7e-09
1sbxA [a.6.1.4] SKI ONCOGENE                                           49   8e-09
3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180      48   1e-08
2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336               48   1e-08
1f46A [d.129.4.1] CELL DIVISION PROTEIN ZIPA                           47   3e-08
1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228                47   3e-08
1jbkA [c.37.1.20] CLPB PROTEIN                                         47   3e-08
1s9hA [c.37.1.20] REP 40 PROTEIN                                       47   3e-08
1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198                      46   4e-08
1vhhA [d.65.1.2] SONIC HEDGEHOG                                        46   5e-08
1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395           46   6e-08
1esmA [c.37.1.6] PANTOTHENATE KINASE                                   45   9e-08
1t3wA [a.236.1.1] DNA PRIMASE                                          45   1e-07
1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132     45   1e-07
1dwmA [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR                 45   1e-07
1tueA [c.37.1.20] REPLICATION PROTEIN E1                               44   2e-07
2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143     42   1e-06
1poiA [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE                   41   1e-06
1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607       41   2e-06
1l3aA [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2            41   2e-06
1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -                  41   2e-06
1jb1A [c.91.1.2] HPRK PROTEIN                                          41   2e-06
1e2hA [c.37.1.1] THYMIDINE KINASE                                      40   3e-06
1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411          39   5e-06
1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298                     39   5e-06
2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165             38   9e-06
1tljA [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622                 38   2e-05
1f8xA [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE                 38   2e-05
1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511            38   2e-05
1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171                                37   2e-05
2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 -...    37   2e-05
1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 ...    37   3e-05
1l1oA [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT                  37   3e-05
2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123                36   4e-05
1viaA [c.37.1.2] SHIKIMATE KINASE                                      36   5e-05
2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87        36   5e-05
2vgmA3 [d.79.3.2] DOM34 A:278 -- 381                                   36   5e-05
1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 ...    36   5e-05
1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135                          36   6e-05
1np6A [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS      35   7e-05
2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445      35   1e-04
1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321                     34   2e-04
1w1wA [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1               34   3e-04
1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL) A...    33   4e-04
1q3tA [c.37.1.1] CYTIDYLATE KINASE                                     33   4e-04
1ckeA [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)               33   5e-04
1tpzA [c.37.1.8] INTERFERON-INDUCIBLE GTPASE                           32   7e-04

>1ji0A [c.37.1.12] ABC TRANSPORTER
          Length = 240

 Score =  145 bits (366), Expect = 6e-38
 Identities = 75/248 (30%), Positives = 112/248 (45%), Gaps = 16/248 (6%)

Query: 3   VLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILF 62
           VLEVQ +   +G + A+  + L+V  G+I ++IG NGAGKTT  + + G+    +G+I+F
Sbjct: 6   VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIF 65

Query: 63  LGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXX 122
            GQDIT        + GI    +  R+F  +TV EN+  G +       +          
Sbjct: 66  NGQDITNKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKR-------- 117

Query: 123 XXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGM 182
                          +  L  R  +L   L  GEQ+ L I                  G+
Sbjct: 118 -------DLEWIFSLFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGL 170

Query: 183 NPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTN 242
            P     + E I KI  E G TILL+E +    ++++    VL+ G  + EGK  E+  N
Sbjct: 171 APILVSEVFEVIQKINQE-GTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDN 229

Query: 243 PRVIEAYL 250
             V +AYL
Sbjct: 230 EXVRKAYL 237


>1b0uA [c.37.1.12] HISTIDINE PERMEASE
          Length = 258

 Score =  137 bits (346), Expect = 1e-35
 Identities = 56/254 (22%), Positives = 99/254 (38%), Gaps = 26/254 (10%)

Query: 4   LEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFL 63
           L V  + KR+GG   +  VSL+   G++ S+IG +G+GK+TF   +  +  P EG I+  
Sbjct: 3   LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVN 62

Query: 64  GQDITGSTPDKAAKLG------------IGRTFQNIRLFGAMTVLENILVGRHIHTRVPY 111
           GQ+I                        +   FQ+  L+  MTVLEN++        +  
Sbjct: 63  GQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 122

Query: 112 LHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXX 171
             A  R                           + +   +L  G+Q+++ I         
Sbjct: 123 HDARERAL-------------KYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPD 169

Query: 172 XXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKI 231
                     ++P+    +   + ++  E G T++++ H+M     +S  +  L  G   
Sbjct: 170 VLLFDEPTSALDPELVGEVLRIMQQLA-EEGKTMVVVTHEMGFARHVSSHVIFLHQGKIE 228

Query: 232 AEGKPEEVRTNPRV 245
            EG PE+V  NP+ 
Sbjct: 229 EEGDPEQVFGNPQS 242


>1sgwA [c.37.1.12] PUTATIVE ABC TRANSPORTER
          Length = 200

 Score =  118 bits (297), Expect = 7e-30
 Identities = 34/226 (15%), Positives = 79/226 (34%), Gaps = 29/226 (12%)

Query: 4   LEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFL 63
           LE++ ++  +   V + ++++ + +G + +  GPNG GKTT    ++    P +G I++ 
Sbjct: 3   LEIRDLSVGYDKPV-LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYN 61

Query: 64  GQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXX 123
           G  IT        K  I    + I +   ++V + +     ++      + ++       
Sbjct: 62  GVPITK------VKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMD------ 109

Query: 124 XXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMN 183
                             +    +    L  G  R++++                   ++
Sbjct: 110 ------------ALESVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAID 157

Query: 184 PKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGS 229
                 + + IL+I  E G+ I+    ++       D    L   S
Sbjct: 158 EDSKHKVLKSILEILKEKGIVIISSREELSY----CDVNENLHKYS 199


>1l7vC [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
          Length = 231

 Score =  112 bits (280), Expect = 6e-28
 Identities = 56/254 (22%), Positives = 94/254 (37%), Gaps = 34/254 (13%)

Query: 3   VLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILF 62
           V ++Q V +       +  +S EV  GEI  ++GPNGAGK+T      G     +G I F
Sbjct: 3   VXQLQDVAEST----RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXT-SGKGSIQF 57

Query: 63  LGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXX 122
            GQ +   +  K   L      Q      A  V   + + +H  TR   L+ +       
Sbjct: 58  AGQPLEAWSATKL-ALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAG----- 111

Query: 123 XXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXX-- 180
                           + L  +       L  GE +++ +                    
Sbjct: 112 ---------------ALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLL 156

Query: 181 -----GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGK 235
                 ++  +  AL + +  +  + GL I+   HD+   +R + R  +L  G  +A G+
Sbjct: 157 DEPXNSLDVAQQSALDKILSALC-QQGLAIVXSSHDLNHTLRHAHRAWLLKGGKXLASGR 215

Query: 236 PEEVRTNPRVIEAY 249
            EEV T P + +AY
Sbjct: 216 REEVLTPPNLAQAY 229


>1q3hA [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score =  109 bits (273), Expect = 4e-27
 Identities = 33/249 (13%), Positives = 69/249 (27%), Gaps = 29/249 (11%)

Query: 3   VLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILF 62
           + +V        G   +  ++L + +GE+ ++ G  G+GKT+   L+ G     EG I  
Sbjct: 20  LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKH 79

Query: 63  LGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXX 122
            G+    S         I         +        +   +                   
Sbjct: 80  SGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDI-------------- 125

Query: 123 XXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGM 182
                                   E    L  G++ ++ +                   +
Sbjct: 126 ------------TKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYL 173

Query: 183 NPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTN 242
           +    E + E  +     M     ++       +R +D+I +L  GS    G   E+++ 
Sbjct: 174 DVFTEEQVFESCVCKL--MANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL 231

Query: 243 -PRVIEAYL 250
            P      +
Sbjct: 232 RPDFSSKLM 240


>1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
          Length = 244

 Score = 95.9 bits (237), Expect = 5e-23
 Identities = 41/237 (17%), Positives = 82/237 (34%), Gaps = 16/237 (6%)

Query: 4   LEVQGVTKRF--GGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRIL 61
           ++V+ VT  +      A++ VS  + +G+  +++G +G+GK+T  NL T  Y  D G I 
Sbjct: 22  VDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSIC 81

Query: 62  FLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXX 121
             G D+         +     +         +                    A       
Sbjct: 82  LDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAME 141

Query: 122 XXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXG 181
                             GL     E   +L  G+++++ I                   
Sbjct: 142 FIENMP-----------QGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSA 190

Query: 182 MNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEE 238
           ++ +   A+Q  + +++     T+L+I H +   +  +D I V+D G  I  G+  +
Sbjct: 191 LDTESERAIQAALDELQ--KNKTVLVIAHRLS-TIEQADEILVVDEGEIIERGRHAD 244


>1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
           A:1 -- 250
          Length = 250

 Score = 95.3 bits (236), Expect = 7e-23
 Identities = 18/239 (7%), Positives = 42/239 (17%), Gaps = 22/239 (9%)

Query: 10  TKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITG 69
           TK +       +   ++  G    V G    G               E   +     +  
Sbjct: 1   TKFY---TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDN 57

Query: 70  STPDKAAKLG-----IGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXX 124
                  +       I         F    +   + V       +               
Sbjct: 58  FGLGLLLQSKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGG------- 110

Query: 125 XXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNP 184
                          G      E    + Y +   + I                      
Sbjct: 111 -----AGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIR 165

Query: 185 KETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNP 243
            +   ++ +         +T      +  L    +    V++    +  G       + 
Sbjct: 166 GDFALVKAWKA--DQAGNVTFRKSARNFNLPXCKAAETTVVEVEEIVDIGSFAPEDIHI 222


>1e69A [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
          Length = 263

 Score = 89.2 bits (220), Expect = 5e-21
 Identities = 29/261 (11%), Positives = 73/261 (27%), Gaps = 37/261 (14%)

Query: 12  RFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGST 71
              G  +  + SL      + +++GPNG+GK+   + +  ++      I    +++  + 
Sbjct: 7   YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAG 66

Query: 72  PDKAAKLGIGRTFQNIRLFG-----------------------------AMTVLENILVG 102
                        + I +                                + V    +VG
Sbjct: 67  SAYVEL-VFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIVG 125

Query: 103 RHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEI 162
           +    R+   +  +                      +    R+D+    L  GE+  + +
Sbjct: 126 QGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEKALVGL 185

Query: 163 ----XXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRI 218
                                  ++    E  +  + +         ++I H+   VM  
Sbjct: 186 ALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHT--QFIVITHNKI-VMEA 242

Query: 219 SDRIAVLDYGSKIAEGKPEEV 239
           +D +  +   + ++   P EV
Sbjct: 243 ADLLHGVTMVNGVSAIVPVEV 263


>1g6hA [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 254

 Score = 87.5 bits (215), Expect = 2e-20
 Identities = 75/254 (29%), Positives = 116/254 (45%), Gaps = 7/254 (2%)

Query: 1   MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
           M +L  + + K FG   A++ VS+ VN+G++  +IGPNG+GK+T  N++TG    DEGR+
Sbjct: 2   MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRV 61

Query: 61  LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPX 120
            F  +DIT   P +    GI RTFQ  +    MTVLEN+L+G       P      +   
Sbjct: 62  YFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWI 121

Query: 121 XXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXX 180
                             +   H  D  A  L  G+ + +EI                  
Sbjct: 122 PKEEEMVEKAFKILEFLKLS--HLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIA 179

Query: 181 GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEV- 239
           G+ P     +   +       G+T L+IEH + +V+   D + V+  G  IAEG+ EE  
Sbjct: 180 GVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEI 238

Query: 240 ---RTNPRVIEAYL 250
               ++P+V+E Y+
Sbjct: 239 KNVLSDPKVVEIYI 252


>1e9rA [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 420

 Score = 83.6 bits (205), Expect = 2e-19
 Identities = 19/233 (8%), Positives = 45/233 (19%), Gaps = 19/233 (8%)

Query: 3   VLEVQGVTKRFGGLVAVNQVSLEV-NEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRIL 61
             +++ +T+     V V  V +    E     V G  G GK+     L         R++
Sbjct: 23  GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMV 82

Query: 62  FLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXX 121
            +  +                               N +   +   R             
Sbjct: 83  IVDPNGDM---LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRG---- 135

Query: 122 XXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXG 181
                                + +  L                                 
Sbjct: 136 -----------KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGF 184

Query: 182 MNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEG 234
           +     E+L     +    +     ++   +   + + D    +    +   G
Sbjct: 185 LEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG 237


>1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
          Length = 285

 Score = 83.3 bits (204), Expect = 3e-19
 Identities = 17/245 (6%), Positives = 46/245 (18%), Gaps = 13/245 (5%)

Query: 1   MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
             ++    V +     +      + +  G+   +IG    GKT+                
Sbjct: 40  PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGT 99

Query: 61  LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPX 120
               +           +  + +  + +    AM     +         + YL        
Sbjct: 100 DEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP------ 153

Query: 121 XXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXX 180
                                     +         ++   +                  
Sbjct: 154 -----YSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLH 208

Query: 181 GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVR 240
               +    + +            I     D  +   I   +  +  G    E +     
Sbjct: 209 SRLLERAAKMNDAFGGGSLTALPVIETQAGD--VSAYIPTNVISITDGQIFLETELFYKG 266

Query: 241 TNPRV 245
             P +
Sbjct: 267 IRPAI 271


>1ex6A [c.37.1.1] GUANYLATE KINASE
          Length = 186

 Score = 83.2 bits (204), Expect = 3e-19
 Identities = 18/203 (8%), Positives = 44/203 (21%), Gaps = 25/203 (12%)

Query: 30  EIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRL 89
               + GP+G GK+T    L   Y    G  +        +        G    F ++  
Sbjct: 2   RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN----GKDYNFVSVDE 57

Query: 90  FGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELA 149
           F +M      +                                              ++ 
Sbjct: 58  FKSMIKNNEFIEWAQFSGNYYGSTVASVKQ---------------VSKSGKTCILDIDMQ 102

Query: 150 RNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGL------ 203
                    +L                    G   +  E++ + +   ++E+        
Sbjct: 103 GVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAH 162

Query: 204 TILLIEHDMRLVMRISDRIAVLD 226
             +++  D+    +        +
Sbjct: 163 DKVIVNDDLDKAYKELKDFIFAE 185


>1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
          Length = 222

 Score = 81.2 bits (199), Expect = 1e-18
 Identities = 16/213 (7%), Positives = 42/213 (19%), Gaps = 24/213 (11%)

Query: 27  NEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQN 86
           N   +  + G  GAGKTT    +       +  ++        S  D+       +    
Sbjct: 1   NPIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGE-VSVDDQLIGDRATQIKTL 59

Query: 87  IRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKD 146
                  +    +              ALL                      + +     
Sbjct: 60  TNGCICCSRSNEL------------EDALL-------DLLDNLDKGNIQFDRLVIECTGM 100

Query: 147 ELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTIL 206
                +         +                       +                  +L
Sbjct: 101 ADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQ----FTIAQSQVGYADRILL 156

Query: 207 LIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEV 239
                     ++ +R+A ++  + +      ++
Sbjct: 157 TKTDVAGEAEKLHERLARINARAPVYTVTHGDI 189


>2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
          Length = 359

 Score = 80.2 bits (196), Expect = 3e-18
 Identities = 21/219 (9%), Positives = 48/219 (21%), Gaps = 24/219 (10%)

Query: 34  VIGPNGAGKTTFFNLLTGIYTPDEG-RI--LFLGQDITGSTPDKAAKLGIGRTFQNIRLF 90
                     TF +  TG + P +  R+  + +   I  S   K  K  +         +
Sbjct: 158 AGHIGNYSHCTFSSEGTGTFVPQQLERVEEVRIETIIPASLQRKVIKAMVTAHPYEEVAY 217

Query: 91  GAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELAR 150
               +                                             +    D    
Sbjct: 218 DVYPLDNKGETLGLGKIGYLQEEM------------------TLGQFAEHVKQSLDVKGA 259

Query: 151 NLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEH 210
            +      K+                    G +   T  +   +      +GL I+   H
Sbjct: 260 RVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGH 319

Query: 211 DMR--LVMRISDRIAVLDYGSKIAEGKPEE-VRTNPRVI 246
           ++   +   +  ++       K+        + T+P + 
Sbjct: 320 NVEKVMKQGVQKQLQEKVDAKKLNVHIHASQLHTDPFIF 358


>1urjA [e.58.1.1] MAJOR DNA-BINDING PROTEIN
          Length = 1028

 Score = 74.3 bits (182), Expect = 2e-16
 Identities = 13/97 (13%), Positives = 22/97 (22%), Gaps = 4/97 (4%)

Query: 11  KRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS 70
           +    LV        V     F  +G  G+ K T              ++         +
Sbjct: 141 RALLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIA 198

Query: 71  TP--DKAAKLGIGRTFQNIRLFGAMTVLENILVGRHI 105
            P       +G   T+        +  L    V    
Sbjct: 199 EPFNANHRSIGEKFTYPLPFFNRPLNRLLFEAVVGPA 235


>1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
          Length = 263

 Score = 73.7 bits (179), Expect = 2e-16
 Identities = 17/222 (7%), Positives = 44/222 (19%), Gaps = 16/222 (7%)

Query: 29  GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIR 88
           G    ++G    GK+T FN LT                +     D  A++          
Sbjct: 2   GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTT 61

Query: 89  LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDEL 148
           +      +  ++ G      +                               +   ++  
Sbjct: 62  ME--FVDIAGLVAGASKGEGLGNKFLANIRE--------------TDAIGHVVRCFENID 105

Query: 149 ARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLI 208
             +       +L +                  G + +    L      +       ++  
Sbjct: 106 PLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRS 165

Query: 209 EHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYL 250
               +  ++       L     +      E           +
Sbjct: 166 VGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFENNPYLDRV 207


>1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
           -- 409
          Length = 330

 Score = 72.2 bits (175), Expect = 7e-16
 Identities = 21/211 (9%), Positives = 50/211 (23%), Gaps = 20/211 (9%)

Query: 5   EVQGVTKRFGGLVAVNQVSLEVNEGEIFSVI-GPNGAGKTTFFNLLTGIYTPDEGRILFL 63
             +G + +     A+  +   + +GE F  + G  G GKT     +          +   
Sbjct: 3   RYRGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPN 62

Query: 64  GQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXX 123
                    +             I  +        +        +   ++  +       
Sbjct: 63  KILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHST 122

Query: 124 XXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMN 183
                            LL R+D +            +                    ++
Sbjct: 123 TR--------------SLLTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLS 168

Query: 184 PKETEALQEFILKIRSEM--GLTILLIEHDM 212
           P   E L+E + +I  E+   +       ++
Sbjct: 169 P---EGLEEILKEIEKELWERVRYFEERGEV 196


>1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
           A:260 -- 622
          Length = 353

 Score = 72.1 bits (175), Expect = 7e-16
 Identities = 14/231 (6%), Positives = 38/231 (16%), Gaps = 17/231 (7%)

Query: 13  FGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTP 72
               + V  ++    E +  +   P+  GKT    +   +       +      +     
Sbjct: 2   LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQ 61

Query: 73  DKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXX 132
                  I        +    +V  N    + I     + +    +              
Sbjct: 62  GHLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSD------------G 107

Query: 133 XXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQE 192
                 +           +    E    +                    ++         
Sbjct: 108 GVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGV 167

Query: 193 FILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNP 243
            I  I         +      L          +    +             
Sbjct: 168 PIEGIIFGGRRPAGVPLVYEALSW---QHGVFVGAAMRSEAKIIMHDPFAM 215


>1mukA [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
          Length = 1256

 Score = 72.0 bits (176), Expect = 7e-16
 Identities = 20/259 (7%), Positives = 49/259 (18%), Gaps = 45/259 (17%)

Query: 1    MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
            M    ++     +     + +  L V        +             L     P     
Sbjct: 1025 MDETLMRARRHSYSSFSKLLEAYLLVKW-----RMCEAREPSVDLRLPLCAGIDPLNSDP 1079

Query: 61   LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAM--TVLENILVGRHIHTRVPYLHALLRT 118
                  +              +T    +    +    +++ L+                 
Sbjct: 1080 FLKMVSVGPMLQSTRKY--FAQTLFMAKTVSGLDVNAIDSALLRLRTLGADK-------- 1129

Query: 119  PXXXXXXXXXXXXXXXXXXYVGLLHRK-DELARNLPYGEQRKLEIXXXXXXXXXXXXXXX 177
                                VGL   + D LA  +   +   +++               
Sbjct: 1130 -----------KALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSL 1178

Query: 178  XXXGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKP- 236
                M     + L +              L       +  +   +  L  G  +      
Sbjct: 1179 DFDSMFKHHVKLLPKDGRH----------LNTDIPPRMGWLRAILRFLGAGMVMTATGVA 1228

Query: 237  -----EEVRTNPRVIEAYL 250
                 E++    R +    
Sbjct: 1229 VDIYLEDIHGGGRSLGQRF 1247


>1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
           417
          Length = 282

 Score = 71.9 bits (175), Expect = 8e-16
 Identities = 23/252 (9%), Positives = 51/252 (20%), Gaps = 43/252 (17%)

Query: 5   EVQGVTKRFG-----------GLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIY 53
             + +T                   V  ++  +  G+   ++ P  AGKT     +    
Sbjct: 4   LFENLTPLHANSRLRXGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSI 63

Query: 54  TPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLH 113
             +    +     I    P++  +       + +          ++ V   +  +   L 
Sbjct: 64  AYNHPDCVLXVLLI-DERPEEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLV 122

Query: 114 ALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXX 173
                                             L             +           
Sbjct: 123 -------------------------EHKKDVIILLDSITRLARAYNTVV------PAVLT 151

Query: 174 XXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAE 233
                     PK        + +  S   +   LI+   +    I +             
Sbjct: 152 GGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKXDEVIYEEFKGTGNXELHLS 211

Query: 234 GKPEEVRTNPRV 245
            K  E R  P +
Sbjct: 212 RKIAEKRVFPAI 223


>1kgdA [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
          Length = 175

 Score = 71.7 bits (174), Expect = 9e-16
 Identities = 13/196 (6%), Positives = 42/196 (21%), Gaps = 26/196 (13%)

Query: 27  NEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQN 86
           +  +   ++G +G G+    N L   +       +                +   +  Q+
Sbjct: 1   HMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQD 60

Query: 87  IRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKD 146
           I     +             T++  +  +                          L    
Sbjct: 61  ISNNEYLE--YGSHEDAMYGTKLETIRKIH----------------------EQGLIAIL 96

Query: 147 ELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTIL 206
           ++        +                           +     +  IL+        + 
Sbjct: 97  DVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQR--LQKESDILQRTYAHYFDLT 154

Query: 207 LIEHDMRLVMRISDRI 222
           +I +++   +R  +  
Sbjct: 155 IINNEIDETIRHLEEA 170


>1t06A [a.118.1.17] HYPOTHETICAL PROTEIN
          Length = 235

 Score = 70.7 bits (172), Expect = 2e-15
 Identities = 12/232 (5%), Positives = 38/232 (16%), Gaps = 27/232 (11%)

Query: 18  AVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAK 77
            V Q    + +     +   NGA +  F      +    +   L                
Sbjct: 5   TVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELYATGNYD- 63

Query: 78  LGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXX 137
                    I          +                ++                     
Sbjct: 64  --AMYFAGIIADPK-AMSESDFDRWIDGAYFYMLSDYVVAVTLSES-------------- 106

Query: 138 YVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXX---GMNPKETEALQEFI 194
              +     +         +                           M     + +    
Sbjct: 107 --NIAQDVADKWIASGDELKMSAGWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSP 164

Query: 195 LKIRSEMGLTILLI----EHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTN 242
            + +S M   +  +           + I+  + +++      +        +
Sbjct: 165 ERTKSAMNNFLNTVAISYVPLHEKAVEIAKEVGIVEVKRDNKKSSLLNASES 216


>2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
          Length = 426

 Score = 70.5 bits (171), Expect = 2e-15
 Identities = 20/259 (7%), Positives = 51/259 (19%), Gaps = 33/259 (12%)

Query: 1   MRVLEVQGVTKRF---------GGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTG 51
               E++ + ++             + +   +L     +    +   G       +L+ G
Sbjct: 72  YDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRM-CSLMQG 130

Query: 52  IYTPDEGRILFLGQDITG-STPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVP 110
              P        G  + G  T        I R            +   +        +  
Sbjct: 131 STLPRRSGA--AGAAVKGVGTMVMELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRT 188

Query: 111 YLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXX 170
            +  +                          L      A  L      K  +        
Sbjct: 189 MVDQVRE-------------SRNPGNAEFEDLIFLARSALILRGSVAHKSCL-------P 228

Query: 171 XXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSK 230
                     G + +        I   R      +  +          S  + +  + + 
Sbjct: 229 ACVYGSAVASGYDFEREGYSLVGIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAA 288

Query: 231 IAEGKPEEVRTNPRVIEAY 249
             + +        +V+   
Sbjct: 289 FEDLRVSSFIRGTKVVPRG 307


>1i1qA [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
          Length = 513

 Score = 70.3 bits (171), Expect = 2e-15
 Identities = 9/108 (8%), Positives = 23/108 (21%), Gaps = 18/108 (16%)

Query: 1   MRVLEVQGVTKRFGGL--VAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEG 58
            +V     V      +     + +          ++   +GA K     L+        G
Sbjct: 384 TKVDRYSYVMHLVSRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRG 443

Query: 59  RILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIH 106
                                +G    +  L   + +   ++      
Sbjct: 444 SYGG----------------AVGYFTAHGDLDTCIVIRSALVENGIAT 475


>1vplA [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 70.1 bits (170), Expect = 3e-15
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 4  LEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFL 63
          + V+ + KR G    +  +S E+ EGEIF +IGPNGAGKTT   +++ +  P  G +   
Sbjct: 3  VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVF 62

Query: 64 GQDI 67
          G+++
Sbjct: 63 GKNV 66



 Score = 46.6 bits (109), Expect = 3e-08
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 201 MGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAY 249
            GLTIL+  H+M  V  + DRIA++  G+ +  G  EE++   +     
Sbjct: 182 EGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIE 230


>1ffhA2 [c.37.1.10] FFH A:89 -- 295
          Length = 200

 Score = 69.7 bits (169), Expect = 4e-15
 Identities = 23/231 (9%), Positives = 50/231 (21%), Gaps = 36/231 (15%)

Query: 21  QVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGI 80
                + +  ++ ++G  G+GKTT    L   Y     R L +  D              
Sbjct: 2   ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR----------P 51

Query: 81  GRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVG 140
               Q   L   + V    ++       +                               
Sbjct: 52  AAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE-----------------------EKA 88

Query: 141 LLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSE 200
            L  +D +  +     Q    +                   ++    +           +
Sbjct: 89  RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEK 148

Query: 201 MGLTILLIEHDMRLV-MRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYL 250
           +G+T L++           +     +        G         R+    L
Sbjct: 149 VGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGLEPFYP--ERLAGRIL 197


>1udwA [c.37.1.6] URIDINE-CYTIDINE KINASE 2
          Length = 204

 Score = 67.9 bits (164), Expect = 1e-14
 Identities = 23/201 (11%), Positives = 49/201 (24%), Gaps = 26/201 (12%)

Query: 28  EGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNI 87
           E  +  V G   +GK++    +  +       +         ++  KA  L     F + 
Sbjct: 1   EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHP 60

Query: 88  RLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDE 147
             F    +L+ +       T    ++  +                          H + E
Sbjct: 61  DAFDNELILKTLKEITEGKTVQIPVYDFVS-------------------------HSRKE 95

Query: 148 LARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILL 207
               +   +    E                        +T  L   +L+  SE G  +  
Sbjct: 96  ETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTR-LSRRVLRDISERGRDLEQ 154

Query: 208 IEHDMRLVMRISDRIAVLDYG 228
           I       ++ +     L   
Sbjct: 155 ILSQYITFVKPAFEEFCLPTK 175


>1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
          Length = 173

 Score = 67.7 bits (164), Expect = 1e-14
 Identities = 20/190 (10%), Positives = 40/190 (21%), Gaps = 26/190 (13%)

Query: 47  NLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIH 106
             +  ++ P    +L  G  +                ++       +T      V     
Sbjct: 2   RGMLPLFEPKGRVLLVDGHHLA---------------YRTFHALKGLTTSRGEPVQAVYG 46

Query: 107 TRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXX 166
                L AL                            R +              +     
Sbjct: 47  FAKSLLKALKEDGDAVIVVFD----------AKAPSFRHEAYGGYKAGRAPTPEDFPRQL 96

Query: 167 XXXXXXXXXXXXXX-GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVL 225
                           +   E + +   + K   + G  + ++  D  L   +SDRI VL
Sbjct: 97  ALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVL 156

Query: 226 DYGSKIAEGK 235
                +    
Sbjct: 157 HPEGYLITPA 166


>1mjgM [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
          Length = 728

 Score = 64.8 bits (156), Expect = 1e-13
 Identities = 23/253 (9%), Positives = 58/253 (22%), Gaps = 28/253 (11%)

Query: 1   MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
            R +++  +                + +G+++  +G N          ++     D   I
Sbjct: 307 TRGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-I 365

Query: 61  LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPX 120
             +G DI          LGI       ++      +    +   I+      H   R   
Sbjct: 366 EVIGPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQR--- 422

Query: 121 XXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXX 180
                               L   KD +A+   +    ++ +                  
Sbjct: 423 ----------------NINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTI 466

Query: 181 GMNPKETEALQEFILKIRSEMGLTILLIEH-------DMRLVMRI-SDRIAVLDYGSKIA 232
             +  + +   E   +   E    +  +            L      + + ++       
Sbjct: 467 FTDEAKVKEYMEVAREKYKERDDRMRGLTDETVDTFYSCVLCQSFAPNHVCIVTPERVGL 526

Query: 233 EGKPEEVRTNPRV 245
            G    +      
Sbjct: 527 CGAVSWLDAKASY 539


>1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
          Length = 119

 Score = 64.1 bits (155), Expect = 2e-13
 Identities = 11/134 (8%), Positives = 28/134 (20%), Gaps = 24/134 (17%)

Query: 29  GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIR 88
           G+I  ++GP  +GK+T        +   + + L +                + +    + 
Sbjct: 2   GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRALPACLLRDVAQEALGVA 61

Query: 89  LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDEL 148
           + G                 +                             V +       
Sbjct: 62  VIGIDEGQFFPD-IVEFCEAMANAGKT-----------------------VIVAALDGTF 97

Query: 149 ARNLPYGEQRKLEI 162
            R         + +
Sbjct: 98  QRKPFGAILNLVPL 111


>1jjvA [c.37.1.1] DEPHOSPHO-COA KINASE
          Length = 194

 Score = 63.9 bits (154), Expect = 2e-13
 Identities = 24/219 (10%), Positives = 46/219 (21%), Gaps = 40/219 (18%)

Query: 29  GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS---TPDKAAKLGIGRTFQ 85
             I  + G  G+GKTT  NL T +  P       +  D+        D      I   F 
Sbjct: 2   TYIVGLTGGIGSGKTTIANLFTDLGVPL------VDADVVAREVVAKDSPLLSKIVEHFG 55

Query: 86  NIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRK 145
              L  A            +         L                       +     +
Sbjct: 56  AQILNRAAL-------RERVFNHDEDKLWLNN---------------------LLHPAIR 87

Query: 146 DELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTI 205
           + + + L                             ++      L         E    I
Sbjct: 88  ERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARS---ANFEQIQRI 144

Query: 206 LLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPR 244
           +  +   +  ++ +D +   D          ++      
Sbjct: 145 MNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLELH 183


>1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
          Length = 213

 Score = 63.8 bits (154), Expect = 2e-13
 Identities = 5/83 (6%), Positives = 20/83 (24%), Gaps = 5/83 (6%)

Query: 18  AVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAK 77
            +   +L+        +   +        + +   Y    G +   G + T    + +  
Sbjct: 135 YIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGMNWTDLITNYSP- 192

Query: 78  LGIGRTFQNIRLFGAMTVLENIL 100
                           ++   ++
Sbjct: 193 --SREDNLQRVFT-VASIRSMLV 212


>1mi8A [b.86.1.2] DNAB INTEIN
          Length = 141

 Score = 63.7 bits (154), Expect = 2e-13
 Identities = 10/105 (9%), Positives = 30/105 (28%), Gaps = 3/105 (2%)

Query: 3   VLEVQGVTKRFGGLV-AVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRIL 61
            + ++ +       + A+N+ ++++   ++   +   G           G          
Sbjct: 18  RVSIKDLLDEKDFEIWAINEQTMKLESAKVS-RVFMTGKKLVYILKTRLGRTIKATANHR 76

Query: 62  FLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIH 106
           FL  D      + + K  I    ++   +    V         + 
Sbjct: 77  FLTIDGWKRLDELSLKEHIALPRKSDISW-DSIVSITETGVEEVF 120


>2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
          Length = 217

 Score = 61.3 bits (147), Expect = 1e-12
 Identities = 22/220 (10%), Positives = 45/220 (20%), Gaps = 19/220 (8%)

Query: 20  NQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLG 79
             ++ +    +   V+    + +T    +L       +G +   G+DI+ + PD   +  
Sbjct: 7   PVLTSKDKITKRXIVVLAXASLETHKIYVLLNCD-DHQGLLKKXGRDISEARPDITHQCL 65

Query: 80  IGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYV 139
           +      I   G + V      G  I                                  
Sbjct: 66  LTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKR---------------FSGLX 110

Query: 140 GLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRS 199
             L  K  +       +  K  I                   +  ++     +      S
Sbjct: 111 VQLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLD---DDES 167

Query: 200 EMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEV 239
                               D    L      A     + 
Sbjct: 168 ICVFVGAXARGKDNFADEYVDEKVGLSNYPLSASVACSKF 207


>2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
          Length = 124

 Score = 60.5 bits (146), Expect = 2e-12
 Identities = 10/97 (10%), Positives = 18/97 (18%), Gaps = 8/97 (8%)

Query: 1   MRVLEVQGVTKRFGG----LVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPD 56
             V       K F      L A     L+ ++  + +              LL       
Sbjct: 27  AIVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAP-LKGQ 85

Query: 57  EGRILFLGQDITGSTPDKAAKL---GIGRTFQNIRLF 90
                 +     G       K+          +    
Sbjct: 86  SEGYGVICDFNLGDDDHADCKIVVPSSLFVCAHFNAQ 122


>2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
          Length = 95

 Score = 60.3 bits (146), Expect = 2e-12
 Identities = 5/59 (8%), Positives = 14/59 (23%), Gaps = 4/59 (6%)

Query: 3  VLEVQGVTKRFGGLVAVNQVSLEVN----EGEIFSVIGPNGAGKTTFFNLLTGIYTPDE 57
           +  +   +     + ++  S         G     +G   + +     LL        
Sbjct: 36 RIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR 94


>1n25A [c.37.1.20] LARGE T ANTIGEN
          Length = 362

 Score = 60.2 bits (144), Expect = 3e-12
 Identities = 19/225 (8%), Positives = 48/225 (21%), Gaps = 24/225 (10%)

Query: 23  SLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS--TPDKAAKLGI 80
              + +   +   GP  +GKTT    L  +       +      +            +  
Sbjct: 148 VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVF 207

Query: 81  GRTFQNIRLFG------AMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXX 134
                             +  L+N+        +V      L                  
Sbjct: 208 EDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFP---------- 257

Query: 135 XXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFI 194
                 +   +  + + L     ++++                       +   AL   +
Sbjct: 258 ---PGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLML 314

Query: 195 LKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYG---SKIAEGKP 236
           +  R        +    +    R+    ++  Y      +A G  
Sbjct: 315 IWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIG 359


>1ckvA [d.137.1.1] PROTEIN (PROTEIN B)
          Length = 141

 Score = 59.9 bits (144), Expect = 3e-12
 Identities = 10/110 (9%), Positives = 21/110 (19%), Gaps = 11/110 (10%)

Query: 4   LEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFL 63
             + G+  +          +  V+E +   ++        TF   +              
Sbjct: 10  AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVN 69

Query: 64  GQDITG----------STPDKAAKLGIGRTFQNIRLFGAMTVLENILVGR 103
            +D  G                    +GR F                   
Sbjct: 70  VEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFL-VDVSSTIGRAYT 118


>1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
          Length = 200

 Score = 59.7 bits (143), Expect = 4e-12
 Identities = 15/168 (8%), Positives = 36/168 (21%), Gaps = 28/168 (16%)

Query: 85  QNIR-LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLH 143
            ++      + + +N+              +                        + L  
Sbjct: 2   THLVWFRQDLRLHDNL---ALAAACR--NSSARV---------------------LALYI 35

Query: 144 RKDELARNLPYGE-QRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMG 202
                         Q +L                         +  A  E + ++ +E  
Sbjct: 36  ATPRQWATHNMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENS 95

Query: 203 LTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYL 250
           +T L   +   +  R  D        + + EG  + V   P  +    
Sbjct: 96  VTHLFYNYQYEVNERARDVEVERALRNVVCEGFDDSVILPPGAVMTGN 143


>1l7lA [b.18.1.16] PA-I GALACTOPHILIC LECTIN
          Length = 121

 Score = 59.5 bits (143), Expect = 4e-12
 Identities = 13/98 (13%), Positives = 21/98 (21%), Gaps = 3/98 (3%)

Query: 20  NQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLG 79
            +V      G++ S+I   G   T             +       +              
Sbjct: 4   GEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP--DQGLICHDAF 61

Query: 80  IGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLR 117
            G     I   G + V    L        V     L+ 
Sbjct: 62  CGALVMKIGNSGTIPV-NTGLFRWVAPNNVQGAITLIY 98


>1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
          Length = 223

 Score = 58.9 bits (141), Expect = 7e-12
 Identities = 8/70 (11%), Positives = 18/70 (25%), Gaps = 4/70 (5%)

Query: 3  VLEVQGVT----KRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEG 58
           + +        ++      +        +     + GPN  GK+T+      I      
Sbjct: 11 GIRITEGRHPVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYI 70

Query: 59 RILFLGQDIT 68
                Q + 
Sbjct: 71 GSYVPAQKVE 80


>1fl9A [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
          Length = 157

 Score = 58.1 bits (139), Expect = 1e-11
 Identities = 15/106 (14%), Positives = 30/106 (28%), Gaps = 5/106 (4%)

Query: 1   MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
            + +  +    RFG   A   + L   +  +  + G  GAGKTT    +           
Sbjct: 5   TQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVK 64

Query: 61  LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIH 106
                 +           G      ++        LE + +  + +
Sbjct: 65  SPTYTLVEEYNIA-----GKMIYHFDLYRLADPEELEFMGIRDYFN 105


>1qhlA [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
          Length = 203

 Score = 56.8 bits (136), Expect = 3e-11
 Identities = 14/112 (12%), Positives = 37/112 (33%), Gaps = 10/112 (8%)

Query: 4   LEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFL 63
            + + +T            + ++ +  + ++ G NGAGK+T          PD   +L  
Sbjct: 2   GKFRSLTLINWN--GFFARTFDL-DELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHG 58

Query: 64  GQDIT------GSTPDKAAKLGIGRTFQNIR-LFGAMTVLENILVGRHIHTR 108
                       +   +  ++ +G   Q +      + +    + G  +  +
Sbjct: 59  KLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQ 110


>1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
          Length = 99

 Score = 56.1 bits (135), Expect = 4e-11
 Identities = 9/58 (15%), Positives = 21/58 (36%)

Query: 184 PKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRT 241
            ++ E L      +     L + L+ H++  +        ++D G ++  G P     
Sbjct: 3   REQEELLAPADGTVELVRALPLALVLHELGALRLGVGAELLVDVGQRLRRGTPWLRVH 60


>1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
          Length = 178

 Score = 54.9 bits (131), Expect = 1e-10
 Identities = 16/117 (13%), Positives = 35/117 (29%), Gaps = 5/117 (4%)

Query: 3   VLEVQGVTKRFG--GLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
           V++   +        L A              +++   G G+ +  N + G Y      +
Sbjct: 36  VIDSPDICWVGCANELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVL 95

Query: 61  LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLR 117
             +G   T +         +  T  +        + E I V + + T     + + R
Sbjct: 96  HIVGAPGTAAQQRGE---LLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYEIDR 149


>1mm8A [c.55.3.4] TN5 TRANSPOSASE
          Length = 455

 Score = 52.5 bits (124), Expect = 5e-10
 Identities = 13/167 (7%), Positives = 35/167 (20%), Gaps = 24/167 (14%)

Query: 82  RTFQNIRLF----GAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXX 137
             F +  L      A  V     + ++    +       +                    
Sbjct: 11  SVFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSEGSK------------AAQEGAYR 58

Query: 138 YVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKI 197
           ++   +   E       G  + +++                    +      + E + K+
Sbjct: 59  FIRNPNVSAE--AIRKAGAMQTVKLAQEFPELLAIEDT------TSLSYRHQVAEELGKL 110

Query: 198 RSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPR 244
            S    +     H + L+   + R   L +                 
Sbjct: 111 GSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPADADEKE 157


>1afrA [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
          Length = 345

 Score = 52.5 bits (124), Expect = 5e-10
 Identities = 5/55 (9%), Positives = 13/55 (23%)

Query: 15 GLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITG 69
                QV+  +   +I      +   +      L  +    + +         G
Sbjct: 3  PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDG 57



 Score = 44.4 bits (103), Expect = 1e-07
 Identities = 4/47 (8%), Positives = 12/47 (25%)

Query: 192 EFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEE 238
           +    I ++           +  +  I     VL +   + +     
Sbjct: 202 QICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRKKISMP 248


>1g6oA [c.37.1.11] CAG-ALPHA
          Length = 323

 Score = 52.4 bits (124), Expect = 6e-10
 Identities = 15/106 (14%), Positives = 29/106 (27%), Gaps = 4/106 (3%)

Query: 1   MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
               E            A++ +   +  G+   V G  G+GKTT+   +      +E  I
Sbjct: 138 SFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERII 197

Query: 61  LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIH 106
                +       K       + F    +  A  +   +       
Sbjct: 198 SIEDTEEIVFKHHK----NYTQLFFGGNITSADCLKSCLRXRPDRI 239


>1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
          Length = 244

 Score = 52.4 bits (123), Expect = 6e-10
 Identities = 9/69 (13%), Positives = 15/69 (21%)

Query: 31 IFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLF 90
          I   +G  G+GKTT           +               P + +            + 
Sbjct: 2  IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEPSIDVREFVTVEEIMR 61

Query: 91 GAMTVLENI 99
                  I
Sbjct: 62 EGYGPNGAI 70


>1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
          Length = 187

 Score = 52.1 bits (123), Expect = 7e-10
 Identities = 8/55 (14%), Positives = 16/55 (29%)

Query: 20 NQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDK 74
             ++ ++ G  +S +G    GK        G  T          + + G     
Sbjct: 2  KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 56


>1cd5A [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
          Length = 266

 Score = 52.0 bits (123), Expect = 8e-10
 Identities = 10/89 (11%), Positives = 19/89 (21%), Gaps = 1/89 (1%)

Query: 1   MRVLEVQGVTKRFG-GLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGR 59
              +  + V        V + +   E     +      +        NLL G     +  
Sbjct: 58  AGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAE 117

Query: 60  ILFLGQDITGSTPDKAAKLGIGRTFQNIR 88
                + I           G+G       
Sbjct: 118 CRQYEEKIRSYGKIHLFMGGVGNDGHIAF 146


>1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
          Length = 171

 Score = 51.9 bits (124), Expect = 9e-10
 Identities = 20/188 (10%), Positives = 37/188 (19%), Gaps = 37/188 (19%)

Query: 71  TPDKAAKLGIGRTFQNIRLFGAMT--VLENILVGR------HIHTRVPYLHALLRTPXXX 122
               A +L       +    GAM   VL N+ +         I+ + P     LR     
Sbjct: 6   DEKYAKELDKAEIDHHKPTAGAMLGHVLSNLFIENIRLTQAGIYAKSPVKCEYLR----- 60

Query: 123 XXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGM 182
                                       +L   E   +                      
Sbjct: 61  --------------EIAQREVEYFFKISDLLLDENEIVPSTTEEFLKYHKFITEDPKAKY 106

Query: 183 NPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTN 242
              E     + +     +     + I   ++L  +     A+                  
Sbjct: 107 WTDE-----DLLESFIVDFQAQNMFITRAIKLANKEEK-FALAA----GVVELYGYNLQV 156

Query: 243 PRVIEAYL 250
            R +   L
Sbjct: 157 IRNLAGDL 164


>1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
          Length = 176

 Score = 51.6 bits (122), Expect = 1e-09
 Identities = 18/189 (9%), Positives = 37/189 (19%), Gaps = 16/189 (8%)

Query: 28  EGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNI 87
            G I  + G  G+GK+T    L  +    +                           Q+ 
Sbjct: 3   GGNILLLSGHPGSGKSTIAEALANLPGVPKVHF-----HSDDLWGYIKHGRIDPWLPQSH 57

Query: 88  RLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDE 147
           +    +  +   + GR+       +   +  P                      LH    
Sbjct: 58  QQNRXIXQIAADVAGRYAKEGYFVILDGVVRP----------DWLPAFTALARPLHYIVL 107

Query: 148 LARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILL 207
                   E+                        +   E   L         +   + + 
Sbjct: 108 RTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTD-QALQSAIN 166

Query: 208 IEHDMRLVM 216
                R  +
Sbjct: 167 ALQSGRFRI 175


>1cr0A [c.37.1.11] DNA PRIMASE/HELICASE
          Length = 241

 Score = 51.5 bits (122), Expect = 1e-09
 Identities = 17/94 (18%), Positives = 33/94 (35%), Gaps = 3/94 (3%)

Query: 7   QGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQD 66
           + V   F G   +N  +L    GE+  V   +G GK+TF       +    G+ +     
Sbjct: 13  ESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVG---L 69

Query: 67  ITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENIL 100
                  +     +      +RL  + ++   I+
Sbjct: 70  AMLEESVEETAEDLIGLHNRVRLRQSDSLKREII 103


>1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
           233
          Length = 190

 Score = 51.3 bits (121), Expect = 1e-09
 Identities = 23/194 (11%), Positives = 41/194 (21%), Gaps = 12/194 (6%)

Query: 29  GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIR 88
           G    ++GP GAGK T    L   +         + + +  S  +   K  +  T    +
Sbjct: 3   GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKK--LKATMDAGK 60

Query: 89  LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDEL 148
           L     VLE I                                         +  RK++L
Sbjct: 61  LVSDEMVLELIEKNLETPPCKNGFLL----------DGFPRTVRQAEMLDDLMEKRKEKL 110

Query: 149 ARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLI 208
              + +     L I                               +         + +  
Sbjct: 111 DSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDA 170

Query: 209 EHDMRLVMRISDRI 222
                +V       
Sbjct: 171 SQTPDVVFASILAA 184


>2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
          221
          Length = 61

 Score = 50.3 bits (120), Expect = 3e-09
 Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 2/58 (3%)

Query: 20 NQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAK 77
          N + +++   ++  VIG N +   T  +    I+  + GRI    ++I      K   
Sbjct: 1  NGIVIDIMPVKVPRVIGKNKSMYETLTS--KSIFVANNGRIWAFSEEILIEAIRKIEN 56


>1g8yA [c.37.1.11] REGULATORY PROTEIN REPA
          Length = 242

 Score = 50.2 bits (118), Expect = 3e-09
 Identities = 8/42 (19%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 4  LEVQGVTKRF-GGLVAVNQVSLEVNEGEIFSVIGPNGAGKTT 44
           +   + + F      ++ V   +  G + +++ P GAGK+ 
Sbjct: 3  HKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSM 44



 Score = 42.8 bits (99), Expect = 4e-07
 Identities = 4/40 (10%), Positives = 12/40 (30%), Gaps = 1/40 (2%)

Query: 210 HDMRL-VMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEA 248
           H + +  +R    ++ +        G  ++ R        
Sbjct: 178 HAVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGV 217


>1tmkA [c.37.1.1] THYMIDYLATE KINASE
          Length = 204

 Score = 50.1 bits (118), Expect = 3e-09
 Identities = 5/45 (11%), Positives = 19/45 (42%), Gaps = 3/45 (6%)

Query: 206 LLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYL 250
             ++   + + +  + I ++D  +K  +     +    +++E  L
Sbjct: 151 TFMKLLDKEIRKGDESITIVDVTNKGIQEVEALIW---QIVEPVL 192



 Score = 40.9 bits (94), Expect = 2e-06
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 29 GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILF 62
          G++  + G +  GKTT  N+L     P+   + F
Sbjct: 3  GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKF 36


>1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
          Length = 122

 Score = 50.1 bits (119), Expect = 3e-09
 Identities = 6/86 (6%), Positives = 18/86 (20%), Gaps = 12/86 (13%)

Query: 18  AVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAK 77
               V L V+E ++          +                 + + G ++          
Sbjct: 33  KFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGAEMEIGFNVSYVL 81

Query: 78  LGIGRTFQNIRLFGAMTVLENILVGR 103
             +            +T   + +   
Sbjct: 82  DVLNALKCENVRM-MLTDSVSSVQIE 106


>1grqA [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
          Length = 178

 Score = 49.7 bits (117), Expect = 4e-09
 Identities = 10/195 (5%), Positives = 29/195 (14%), Gaps = 24/195 (12%)

Query: 29  GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIR 88
             +  + G + AGK+     L  +                       +  G      +  
Sbjct: 3   TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAM-PLKMQSAEGGIEFDADGG 61

Query: 89  LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDEL 148
           +                   +    A                        +         
Sbjct: 62  VSIGPEFRALEGAWAEGVVAMARAGA----------------------RIIIDDVFLGGA 99

Query: 149 ARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLI 208
           A    +                              +      +    +   +   + + 
Sbjct: 100 AAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVD 159

Query: 209 EHDMRLVMRISDRIA 223
                  +  +  IA
Sbjct: 160 TTHKE-SIECAWAIA 173


>1em8A [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
          Length = 147

 Score = 49.4 bits (118), Expect = 5e-09
 Identities = 11/67 (16%), Positives = 19/67 (28%)

Query: 181 GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVR 240
                  E L   I   R   G  +L+   D +   R+ + +      S +      E  
Sbjct: 15  VDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGP 74

Query: 241 TNPRVIE 247
                +E
Sbjct: 75  RGGAPVE 81


>1e6cA [c.37.1.2] SHIKIMATE KINASE
          Length = 170

 Score = 49.2 bits (116), Expect = 5e-09
 Identities = 12/79 (15%), Positives = 21/79 (26%), Gaps = 2/79 (2%)

Query: 30  EIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAA--KLGIGRTFQNI 87
           E   ++G  G G TT    L      +        Q  +G T       +   G   +  
Sbjct: 3   EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRES 62

Query: 88  RLFGAMTVLENILVGRHIH 106
               A+     ++      
Sbjct: 63  EALQAVATPNRVVATGGGM 81


>2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
          Length = 152

 Score = 49.1 bits (115), Expect = 6e-09
 Identities = 10/58 (17%), Positives = 20/58 (34%)

Query: 28 EGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQ 85
          +G ++ V  P+GAGK++    L       + +        TG            +  +
Sbjct: 1  QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIR 58


>1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
          Length = 296

 Score = 49.1 bits (116), Expect = 6e-09
 Identities = 8/46 (17%), Positives = 14/46 (30%)

Query: 23 SLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDIT 68
                     ++G    GK+TFF  +T     +     +   D  
Sbjct: 4  WGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPE 49


>1d6jA [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
          Length = 177

 Score = 48.9 bits (115), Expect = 7e-09
 Identities = 9/51 (17%), Positives = 15/51 (29%)

Query: 13 FGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFL 63
             L    +  L    G    + G + +GK+T    L      D     + 
Sbjct: 2  ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR 52


>1sbxA [a.6.1.4] SKI ONCOGENE
          Length = 106

 Score = 48.6 bits (115), Expect = 8e-09
 Identities = 5/64 (7%), Positives = 18/64 (28%), Gaps = 1/64 (1%)

Query: 182 MNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAE-GKPEEVR 240
           +N    +   + I  +  E+ +       D   ++++   +        +      E + 
Sbjct: 41  LNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGILPFSAPSCGLITKTDAERLC 100

Query: 241 TNPR 244
               
Sbjct: 101 NALL 104


>3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
          Length = 179

 Score = 47.8 bits (112), Expect = 1e-08
 Identities = 7/48 (14%), Positives = 15/48 (31%), Gaps = 4/48 (8%)

Query: 3  VLEVQGVT----KRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFF 46
          VL+  G       + G   ++   S   +    +  +G +   K    
Sbjct: 5  VLKAGGKIYQGWTKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIE 52


>2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
          Length = 182

 Score = 47.8 bits (113), Expect = 1e-08
 Identities = 9/89 (10%), Positives = 18/89 (20%), Gaps = 5/89 (5%)

Query: 23  SLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGR 82
                 G++  +  P G G          +   D    +     +     +    L    
Sbjct: 3   QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKARNLMLSLDATA 62

Query: 83  -----TFQNIRLFGAMTVLENILVGRHIH 106
                 F  +     +    NI       
Sbjct: 63  CTDVTGFGLLGHAWNICKNSNIGARIFFE 91


>1f46A [d.129.4.1] CELL DIVISION PROTEIN ZIPA
          Length = 139

 Score = 46.8 bits (110), Expect = 3e-08
 Identities = 10/158 (6%), Positives = 31/158 (19%), Gaps = 25/158 (15%)

Query: 44  TFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGR 103
              N+     +   G +L              +    G  F ++ ++      +      
Sbjct: 6   IIMNVAAHHGSELNGELLL------------NSIQQAGFIFGDMNIYHRHLSPDGSGPAL 53

Query: 104 HIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIX 163
                +                                +  +     +     +  L+  
Sbjct: 54  FSLANMVKPGTFDPEM-------------KDFTTPGVTIFMQVPSYGDELQLFKLMLQSA 100

Query: 164 XXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEM 201
                             M P++    Q+ I +++   
Sbjct: 101 QHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN 138


>1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
          Length = 118

 Score = 46.8 bits (110), Expect = 3e-08
 Identities = 12/89 (13%), Positives = 31/89 (34%), Gaps = 6/89 (6%)

Query: 19  VNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKL 78
           V  V  E+   ++  ++       +    + T   T  +G+I+  G +    +     K 
Sbjct: 1   VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNKVEDSGLTRPKY 55

Query: 79  GIGRTFQN-IRLFGAMTVLENILVGRHIH 106
            +  T  +    F  +  + N+ +    +
Sbjct: 56  SLTLTDYDGSNNFNFVINMANMKIQPGNY 84


>1jbkA [c.37.1.20] CLPB PROTEIN
          Length = 189

 Score = 46.6 bits (109), Expect = 3e-08
 Identities = 12/66 (18%), Positives = 19/66 (28%), Gaps = 2/66 (3%)

Query: 4  LEVQGVTKRFGGLVAVNQVS--LEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRIL 61
           E   +    G    + +    L+        +IG  G GKT     L       E    
Sbjct: 16 AEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEG 75

Query: 62 FLGQDI 67
            G+ +
Sbjct: 76 LKGRRV 81


>1s9hA [c.37.1.20] REP 40 PROTEIN
          Length = 268

 Score = 46.5 bits (109), Expect = 3e-08
 Identities = 14/101 (13%), Positives = 29/101 (28%), Gaps = 4/101 (3%)

Query: 2   RVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRIL 61
           ++LE+ G   ++   V +   + +  +     + GP   GKT     +            
Sbjct: 78  KILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNW 137

Query: 62  FLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVG 102
                      DK     +    +       +   + IL G
Sbjct: 138 TNENFPFNDCVDK----MVIWWEEGKMTAKVVESAKAILGG 174


>1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
          Length = 157

 Score = 46.5 bits (110), Expect = 4e-08
 Identities = 10/173 (5%), Positives = 33/173 (19%), Gaps = 30/173 (17%)

Query: 55  PDEGRILFLGQDITGSTP-DKAAKLGIGRTFQNIR-LFGAMTVLENILVGRHIHTR--VP 110
             +  +     D           K      + +I           +              
Sbjct: 2   DPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCC 61

Query: 111 YLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXX 170
            ++  L++                    + +L +K  +       ++++           
Sbjct: 62  KINKKLKS--------------------ITMLRKK--IVHFTGSDQRKQANAAFLVGCYM 99

Query: 171 XXXXXXXXXXGMNPKETEALQEFILK----IRSEMGLTILLIEHDMRLVMRIS 219
                                    +          +T+L   H ++  M+  
Sbjct: 100 VIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYG 152


>1vhhA [d.65.1.2] SONIC HEDGEHOG
          Length = 157

 Score = 46.1 bits (108), Expect = 5e-08
 Identities = 6/111 (5%), Positives = 21/111 (18%)

Query: 140 GLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRS 199
            L        +     E+ K                      +  +  +     +     
Sbjct: 18  TLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVM 77

Query: 200 EMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYL 250
                + L   +           ++   G  +     +  R+   ++    
Sbjct: 78  NQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLA 128


>1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
          Length = 221

 Score = 45.8 bits (107), Expect = 6e-08
 Identities = 6/70 (8%), Positives = 14/70 (20%)

Query: 181 GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVR 240
            ++  E   +      +    G TIL         + +   +            +     
Sbjct: 83  RVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDMLSPKYAELVYYG 142

Query: 241 TNPRVIEAYL 250
                    L
Sbjct: 143 FWYAPEREAL 152


>1esmA [c.37.1.6] PANTOTHENATE KINASE
          Length = 311

 Score = 45.1 bits (105), Expect = 9e-08
 Identities = 6/50 (12%), Positives = 14/50 (28%), Gaps = 4/50 (8%)

Query: 1   MRVLEVQGVTKRFG----GLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFF 46
           + +  +             ++     +       I S+ G    GK+T  
Sbjct: 51  LPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTA 100



 Score = 38.6 bits (88), Expect = 9e-06
 Identities = 6/46 (13%), Positives = 11/46 (23%)

Query: 204 TILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAY 249
           +I +   +  L     +R      G+                 EA 
Sbjct: 221 SIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAI 266


>1t3wA [a.236.1.1] DNA PRIMASE
          Length = 134

 Score = 44.9 bits (105), Expect = 1e-07
 Identities = 12/159 (7%), Positives = 35/159 (22%), Gaps = 28/159 (17%)

Query: 42  KTTFFNLLTGI--YTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENI 99
           K T   +L G+    P+   ++   +++         +  +        L         +
Sbjct: 1   KRTTXRILIGLLVQNPELATLVPPLENLD--------ENKLPGLGLFRELVNTCLSQPGL 52

Query: 100 LVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGEQRK 159
             G+ +       +A                           +  K+   +         
Sbjct: 53  TTGQLLEHYRGTNNAATL----------------EKLSXWDDIADKNIAEQTFTDSLNHX 96

Query: 160 LEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIR 198
            +                   G++ +E   L     ++ 
Sbjct: 97  FDS--LLELRQEELIARERTHGLSNEERLELWTLNQELA 133


>1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
          Length = 132

 Score = 44.9 bits (105), Expect = 1e-07
 Identities = 8/107 (7%), Positives = 22/107 (20%), Gaps = 3/107 (2%)

Query: 139 VGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEA-LQEFILKI 197
               H   +    +  G      +                   +     E      + ++
Sbjct: 16  PAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERM 75

Query: 198 RSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPR 244
             ++    +           +  R  +     +   G P E+   P 
Sbjct: 76  ADKLRQAGVAFTRGDEA--LMQQRKVMGLLCLQDPFGLPLEIYYGPA 120


>1dwmA [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
          Length = 69

 Score = 44.8 bits (106), Expect = 1e-07
 Identities = 7/49 (14%), Positives = 13/49 (26%), Gaps = 1/49 (2%)

Query: 188 EALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKP 236
                 + +        I+L E          DR+ V+     +    P
Sbjct: 19  NMAAATVERENRN-VHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSVP 66


>1tueA [c.37.1.20] REPLICATION PROTEIN E1
          Length = 201

 Score = 43.7 bits (102), Expect = 2e-07
 Identities = 16/110 (14%), Positives = 25/110 (22%), Gaps = 2/110 (1%)

Query: 2   RVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRIL 61
           + L  Q +      L A+        +       GP   GK+ F               +
Sbjct: 27  QFLRYQQIEFI-TFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFV 85

Query: 62  FLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPY 111
                     P    K+ +             T + N L G  I      
Sbjct: 86  NSTSHFW-LEPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDPLI 134


>2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
          Length = 133

 Score = 41.6 bits (98), Expect = 1e-06
 Identities = 7/55 (12%), Positives = 17/55 (30%), Gaps = 4/55 (7%)

Query: 39  GAGKTTFFNLLTGIYTPDEG----RILFLGQDITGSTPDKAAKLGIGRTFQNIRL 89
             G   +F L   +     G    R+     +   +      +  +  TF++  +
Sbjct: 75  KKGSDPYFTLQAVLDDQSSGRGTERVTLYDVNFDSAKIASLDEEEVPFTFEDFDV 129


>1poiA [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
          Length = 317

 Score = 41.2 bits (96), Expect = 1e-06
 Identities = 11/96 (11%), Positives = 24/96 (25%), Gaps = 3/96 (3%)

Query: 18  AVNQVSLEVNEGEIFSVIGPNGAG--KTTFFNLLTGIYTPDEGRILFLGQDITGST-PDK 74
             + ++  V+ G+  ++ G           F +L    T   G     G D        +
Sbjct: 6   LKDAIAKYVHSGDHIALGGFTTDRKPYAAVFEILRQGITDLTGLGGAAGGDWDMLIGNGR 65

Query: 75  AAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVP 110
                   T  +     +    +    G+       
Sbjct: 66  VKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYS 101


>1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
          Length = 124

 Score = 41.0 bits (95), Expect = 2e-06
 Identities = 5/100 (5%), Positives = 18/100 (18%), Gaps = 4/100 (4%)

Query: 146 DELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTI 205
                 L   E+    I                   +  +      + +     +     
Sbjct: 7   QYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAI-KTHEPT 65

Query: 206 LLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRV 245
            ++ +  +L        +  D      + +          
Sbjct: 66  TVVTYLFKLTH---QVSSCYDVLWVAGQTEELATARLALY 102


>1l3aA [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
          Length = 166

 Score = 40.9 bits (95), Expect = 2e-06
 Identities = 15/183 (8%), Positives = 38/183 (20%), Gaps = 26/183 (14%)

Query: 58  GRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLR 117
           G  ++ G+      P               +L     V+        +         +  
Sbjct: 7   GYSIYKGKAALTVEPRS--PEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFS 64

Query: 118 TPXXXXXXXXXXXXXXXXXXYVGLL-HRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXX 176
                                + L      E   +   G   +  +              
Sbjct: 65  ------------LSVTEIGSIISLGTKDSCEFFHDPNKGRSDEGRVRKVLKVEPLPDGSG 112

Query: 177 XXXXGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAV--LDYGSKIAEG 234
                 N      L            + I + + +  +++   + +    L + + +   
Sbjct: 113 H---FFNLSVQNKLINLDEN------IYIPVTKAEFAVLVSAFNFVMPYLLGWHTAVNSF 163

Query: 235 KPE 237
           KPE
Sbjct: 164 KPE 166


>1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
          Length = 369

 Score = 40.8 bits (93), Expect = 2e-06
 Identities = 7/95 (7%), Positives = 26/95 (27%), Gaps = 2/95 (2%)

Query: 140 GLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRS 199
                       +  G   +L +                   ++ +    L   + +   
Sbjct: 273 ERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYL- 331

Query: 200 EMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEG 234
           +    ++L+ HD   +   +D +  +   +  ++ 
Sbjct: 332 KKIPQVILVSHDEE-LKDAADHVIRISLENGSSKV 365



 Score = 38.5 bits (87), Expect = 9e-06
 Identities = 12/67 (17%), Positives = 24/67 (35%), Gaps = 6/67 (8%)

Query: 1  MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI 60
          M++  V           + +   +E  EG I  +IG NG+GK++  + +           
Sbjct: 1  MKLERV-----TVKNFRSHSDTVVEFKEG-INLIIGQNGSGKSSLLDAILVGLYWPLRIK 54

Query: 61 LFLGQDI 67
               + 
Sbjct: 55 DIKKDEF 61


>1jb1A [c.91.1.2] HPRK PROTEIN
          Length = 161

 Score = 40.7 bits (94), Expect = 2e-06
 Identities = 7/45 (15%), Positives = 15/45 (33%), Gaps = 1/45 (2%)

Query: 18 AVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILF 62
          + + V +++  G    + G +G GK+     L             
Sbjct: 4  SXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRV 47


>1e2hA [c.37.1.1] THYMIDINE KINASE
          Length = 306

 Score = 40.2 bits (92), Expect = 3e-06
 Identities = 20/222 (9%), Positives = 46/222 (20%), Gaps = 4/222 (1%)

Query: 29  GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIR 88
                + GP+G GKTT   LL          + +           +          +  +
Sbjct: 4   LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVL----GASETIANIYTTQHRLDQ 59

Query: 89  LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDEL 148
              +      ++    I   +PY                              +      
Sbjct: 60  GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCY 119

Query: 149 ARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLI 208
                       +                        E   +     + R    L + ++
Sbjct: 120 PAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAML 179

Query: 209 EHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYL 250
               R+   +++ +  L  G    E   +     P + +   
Sbjct: 180 AAIRRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF 221


>1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
          Length = 181

 Score = 39.4 bits (91), Expect = 5e-06
 Identities = 5/46 (10%), Positives = 13/46 (28%)

Query: 24 LEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITG 69
                +  +++G   +GK+   N L  ++                
Sbjct: 2  ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEK 47


>1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
          Length = 212

 Score = 39.4 bits (90), Expect = 5e-06
 Identities = 12/108 (11%), Positives = 23/108 (21%), Gaps = 24/108 (22%)

Query: 53  YTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYL 112
                G ++      +        +  +G TF +IR   +       L  +     V   
Sbjct: 125 LIHTSGGLVADTPGFSSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCAV--K 182

Query: 113 HALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDELARNLPYGE-QRK 159
            A+                         L   + +           RK
Sbjct: 183 QAVED---------------------GELKQYRYDHYVEFMTEIKDRK 209


>2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
          Length = 164

 Score = 38.5 bits (88), Expect = 9e-06
 Identities = 8/76 (10%), Positives = 22/76 (28%), Gaps = 3/76 (3%)

Query: 31  IFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLF 90
           +  + GP+   K+T    L+        +        +G   ++       +      + 
Sbjct: 2   LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSG---NEKLFEHFNKLADEDNVI 58

Query: 91  GAMTVLENILVGRHIH 106
               V  N++  +   
Sbjct: 59  IDRFVYSNLVYAKKFK 74


>1tljA [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
          Length = 189

 Score = 37.7 bits (86), Expect = 2e-05
 Identities = 18/198 (9%), Positives = 47/198 (23%), Gaps = 17/198 (8%)

Query: 14  GGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPD 73
               A+N++  +   G +   I           N +    +   GRI  +  ++     +
Sbjct: 6   LREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYT-QSSCSGRITIVDAEMPWDRKN 64

Query: 74  KAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXX 133
                 I +    I       VL    V R        +  +                  
Sbjct: 65  ---STIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAK------------NIE 109

Query: 134 XXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEF 193
                + +          +    Q+ + +                   ++  + + L   
Sbjct: 110 TGWDILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNV 169

Query: 194 ILKIRSEMGLTILLIEHD 211
             ++ +  G   + +  D
Sbjct: 170 CNEVLAR-GKQKMNLLKD 186


>1f8xA [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
          Length = 156

 Score = 37.7 bits (86), Expect = 2e-05
 Identities = 5/97 (5%), Positives = 23/97 (23%), Gaps = 1/97 (1%)

Query: 149 ARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLI 208
           A      + +  +                    ++ +      +   +   +        
Sbjct: 9   AGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATY 68

Query: 209 EHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRV 245
            +D+   ++ +D +  +    +   G   E+      
Sbjct: 69  NNDLNG-IKTNDIMLGVYIPDEEDVGLGMELGYALSQ 104


>1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
          Length = 122

 Score = 37.6 bits (86), Expect = 2e-05
 Identities = 6/84 (7%), Positives = 18/84 (21%), Gaps = 7/84 (8%)

Query: 26  VNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQ 85
             +G    +       +      L   +    G   +   +          K  +    Q
Sbjct: 3   PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNN-------KTELLSLIQ 55

Query: 86  NIRLFGAMTVLENILVGRHIHTRV 109
           +    G+  ++ +           
Sbjct: 56  DFIGSGSGLIIPDQWEDDKDSVVG 79


>1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
          Length = 170

 Score = 37.4 bits (86), Expect = 2e-05
 Identities = 6/89 (6%), Positives = 13/89 (14%), Gaps = 9/89 (10%)

Query: 139 VGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIR 198
             ++        NL    +R+                                    K+ 
Sbjct: 26  GPVVGLVVLDPNNLKTTPRRRAWFLENVRALREAYR------ARGGALWVLEGLPWEKVP 79

Query: 199 SE---MGLTILLIEHDMRLVMRISDRIAV 224
                +    +          R  D    
Sbjct: 80  EAARRLKAKAVYALTSHTPYGRYRDGRVR 108


>2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
           136
          Length = 135

 Score = 37.4 bits (86), Expect = 2e-05
 Identities = 5/32 (15%), Positives = 9/32 (28%)

Query: 201 MGLTILLIEHDMRLVMRISDRIAVLDYGSKIA 232
             + ++L          I        Y +KI 
Sbjct: 102 DCVMMVLASDYYDETDYIRQYDNFKKYIAKIN 133


>1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
           126
          Length = 125

 Score = 36.9 bits (84), Expect = 3e-05
 Identities = 5/61 (8%), Positives = 17/61 (27%)

Query: 184 PKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNP 243
            +    L+  + +++ ++      +          S+    +   +    G        P
Sbjct: 13  AQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLP 72

Query: 244 R 244
           R
Sbjct: 73  R 73


>1l1oA [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
          Length = 115

 Score = 36.8 bits (84), Expect = 3e-05
 Identities = 5/88 (5%), Positives = 18/88 (20%), Gaps = 4/88 (4%)

Query: 18  AVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAK 77
            +N   L     +    +G       T    +  +   +         +          +
Sbjct: 9   RINAGMLAQFIDKPVCFVGRLEKIHPTG--KMFILSDGEGKNGTIELMEPLDEEISGIVE 66

Query: 78  LGIGRTFQNIRLFGAMTVLENILVGRHI 105
           +    T +        + ++        
Sbjct: 67  VVGRVTAKAT--ILCTSYVQFKEDSHPF 92


>2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
          Length = 121

 Score = 36.4 bits (83), Expect = 4e-05
 Identities = 6/135 (4%), Positives = 20/135 (14%), Gaps = 22/135 (16%)

Query: 74  KAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXX 133
                      +   +    T  + +     I +                          
Sbjct: 8   TEIGKHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQV---------------TLAE 52

Query: 134 XXXXYVGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEF 193
                +G  +       +      + +                      +          
Sbjct: 53  GDHLKIGDTNYTITKVGSFANSNLQSIAH-------STLIFADAPTDEDDVIRNGVYLTP 105

Query: 194 ILKIRSEMGLTILLI 208
               +  +G TI  +
Sbjct: 106 HQLPKITIGTTIDYL 120


>1viaA [c.37.1.2] SHIKIMATE KINASE
          Length = 161

 Score = 36.1 bits (82), Expect = 5e-05
 Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 8/53 (15%)

Query: 30 EIFSVIGPNGAGKTTFFNLLTG----IYTPDEGRILFLGQDITGSTPDKAAKL 78
          +    IG  G+GK+T    L      ++   +    FL +        +  + 
Sbjct: 1  KNIVFIGFXGSGKSTLARALAKDLDLVFLDSD----FLIEQKFNQKVSEIFEQ 49


>2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
          Length = 84

 Score = 36.0 bits (83), Expect = 5e-05
 Identities = 4/82 (4%), Positives = 18/82 (21%), Gaps = 17/82 (20%)

Query: 139 VGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKE-TEALQEF--IL 195
           +     +      L +  ++ + +                       E    + +   I 
Sbjct: 14  IEEHDERTRAKARLSWAGRQXVGVGLARL--------------DPADEPVAQIGDELAIA 59

Query: 196 KIRSEMGLTILLIEHDMRLVMR 217
           +  S++   +  +         
Sbjct: 60  RALSDLANQLFALTSSDIEAST 81


>2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
          Length = 104

 Score = 36.0 bits (83), Expect = 5e-05
 Identities = 5/44 (11%), Positives = 13/44 (29%), Gaps = 1/44 (2%)

Query: 181 GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAV 224
             N  + E   + +  +    G   L++     L   +     +
Sbjct: 49  SDNIAQREEYLKLMDSVE-SNGGKALVLSTLHSLGEELDQLTGI 91


>1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351
          -- 522
          Length = 172

 Score = 35.9 bits (81), Expect = 5e-05
 Identities = 8/24 (33%), Positives = 11/24 (45%)

Query: 30 EIFSVIGPNGAGKTTFFNLLTGIY 53
          E+   +G  GAGK+TF        
Sbjct: 15 EVVVAVGFPGAGKSTFIQEHLVSA 38


>1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
          Length = 132

 Score = 35.9 bits (82), Expect = 6e-05
 Identities = 7/62 (11%), Positives = 19/62 (30%), Gaps = 4/62 (6%)

Query: 181 GMNPKETEALQEFILKIRSEMGLTIL----LIEHDMRLVMRISDRIAVLDYGSKIAEGKP 236
            +    T      +          +     L++   +  +   + +A+L  G ++A    
Sbjct: 25  PVKGFMTREEALSVAHEMRLPTGEVWTIPILLQFREKPRVGPGNTVALLHGGERVALLHV 84

Query: 237 EE 238
            E
Sbjct: 85  AE 86


>1np6A [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
          Length = 158

 Score = 35.5 bits (80), Expect = 7e-05
 Identities = 7/38 (18%), Positives = 11/38 (28%)

Query: 29 GEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQD 66
            + +    +G GKTT    L         R   +   
Sbjct: 2  IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHT 39


>2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
          Length = 392

 Score = 34.9 bits (79), Expect = 1e-04
 Identities = 10/105 (9%), Positives = 23/105 (21%), Gaps = 1/105 (0%)

Query: 139 VGLLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIR 198
             +  + + L    P      L+                   G +   T   +     + 
Sbjct: 11  KSIQSQANPLKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVT 70

Query: 199 SEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNP 243
                T    E D    +++++ I       +             
Sbjct: 71  EXGF-TNFAXEEDWGNGLKLNEYIQTGKGNPREFLKLLYPTDEII 114


>1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
          Length = 109

 Score = 33.9 bits (77), Expect = 2e-04
 Identities = 9/119 (7%), Positives = 24/119 (20%), Gaps = 13/119 (10%)

Query: 89  LFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVGLLHRKDEL 148
           L   ++    +      +     L +  +                       ++      
Sbjct: 3   LRPGISFHPKLRPILLPNKNSADLTSPEKI-----------QAIMTSLQDFKIVPIDPT- 50

Query: 149 ARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILL 207
            +N+   E  +  +                  G++P     L   I +          L
Sbjct: 51  -KNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL 108


>1w1wA [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
          Length = 274

 Score = 33.5 bits (76), Expect = 3e-04
 Identities = 9/30 (30%), Positives = 15/30 (50%)

Query: 20 NQVSLEVNEGEIFSVIGPNGAGKTTFFNLL 49
              +   E    S+IGPNG+GK+   + +
Sbjct: 16 GVTKVGFGESNFTSIIGPNGSGKSNMMDAI 45


>1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
           A:141 -- 314
          Length = 174

 Score = 32.9 bits (74), Expect = 4e-04
 Identities = 6/74 (8%), Positives = 14/74 (18%), Gaps = 4/74 (5%)

Query: 26  VNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQ 85
                  ++ G   A      +     +      I     +       +   LG      
Sbjct: 40  EKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANT---FQHQLGALGCSANPI 96

Query: 86  NIRLFGAMTVLENI 99
           N +        +  
Sbjct: 97  NNQSP-GNWTPDRA 109


>1q3tA [c.37.1.1] CYTIDYLATE KINASE
          Length = 223

 Score = 32.9 bits (74), Expect = 4e-04
 Identities = 11/92 (11%), Positives = 26/92 (28%), Gaps = 17/92 (18%)

Query: 29  GEIFSVIGPNGAGKTTFFNLL---TGIYTPDEGRILFLGQDITGSTPDKAAKL------- 78
               ++ GP  +GK+T   ++    G    D G +    +  T         +       
Sbjct: 3   TIQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMY---RAATYMALKNQLGVEEVEALL 59

Query: 79  ----GIGRTFQNIRLFGAMTVLENILVGRHIH 106
                   +F        +  + ++ +   I 
Sbjct: 60  ALLDQHPISFGRSETGDQLVFVGDVDITHPIR 91


>1ckeA [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
          Length = 212

 Score = 32.7 bits (73), Expect = 5e-04
 Identities = 10/38 (26%), Positives = 17/38 (44%), Gaps = 3/38 (7%)

Query: 29 GEIFSVIGPNGAGKTTFFNLL---TGIYTPDEGRILFL 63
            + ++ GP+GAGK T    +      +  D G I  +
Sbjct: 3  APVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRV 40


>1tpzA [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
          Length = 395

 Score = 32.1 bits (73), Expect = 7e-04
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 32 FSVIGPNGAGKTTFFNLLTGIYTPDEG 58
           +V G  G+GK++F N L GI   +EG
Sbjct: 59 VAVTGETGSGKSSFINTLRGIGNEEEG 85


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.142    0.417 

Gapped
Lambda     K      H
   0.267   0.0565    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 16,961,676
Number of extensions: 1254425
Number of successful extensions: 6152
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 5810
Number of HSP's successfully gapped: 361
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)