[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK85845.1


[Show Plain Result]

## Summary of Sequence Search
   1::298
  96::244  PF01039 0.0% 29.9319727891156  Carboxyl transferase domain 
   1::298


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDG
PF01039         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
PF01039         -------------------------dlafhrvtelglkrlprdgvvtgsGaviGravevvaqdftvlggs


                         +         -         -         -         -         *         -:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
PF01039         lgpakaekllkaqelalkeglpligindsgGaegriqegvenlrgsGkifganskasg.eipqislvtgr


                         -         -         -         +         -         -         -:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
PF01039         caGg.gaYlpalgdriimveetspifltGpdvvk------------------------------------


                         -         *         -         -         -         -         +:350
query           TKAPADNANAVVPLAASA----------------------------------------------------
PF01039         ----------------------------------------------------------------------