[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK85915.1


[Show Plain Result]

## Summary of Sequence Search
   1::107
   8::100  PF02575 0.0% 52.6881720430108  Uncharacterised BCR, YbaB family COG0718 
   1::107


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDL
PF02575         -------mkqaqkmqekmeeaqeelaekevegesggglVkVtvnGkgevksveidpelldpedkemledl


                         -         -         *         -         -         -         -:140
query           IVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF---------------------------------
PF02575         ivaAindAlkkaeelakeemskltgglnlp----------------------------------------