[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK85965.2


[Show Plain Result]

## Summary of Sequence Search
   1::1782
 453::493  PF01645 0.0% 32.4324324324324  Conserved region in glutamate synthase 
 569::627  PF01645 0.0% 34.4827586206897  Conserved region in glutamate synthase 
 942::1252 PF01645 0.0% 51.1326860841424  Conserved region in glutamate synthase 
 407::681  PF04898 0.0% 35.0553505535055  Glutamate synthase central domain 
   6::322  PF00310 0.0% 36.5695792880259  Glutamine amidotransferases class-II 
1376::1533 PF01493 0.0% 46.2025316455696  GXGXG motif 
   1::1782


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNALKEQGFSVLLV
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         -----tGDgaGilvqipeeffkesakeqgielpekgeyavgqiFlpqeeerree.kkeiekeveeeglev
PF01493         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSAR
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         lgwRsvpvdrdvlgesakksePfieqvfvkkrsv......seddlerklfvirkkleksidaekvfYics
PF01493         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEA
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         lssrtivYKGlltpeqlkkyyeDLkdeefksalaivHvRfsTntspswenahPfrvlahNGeintikgnk
PF01493         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AVALAKNASIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYE
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         nllkareeslkseefgsikklrPiveenesDseildnvlelltr.tgreleeavmmliPeAyqkdpnlsp
PF01493         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDH
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         eekafyeylkklmepwdGpaalvftdgkkvgasldrnglRpa----------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TERRAFSTVEALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         --------------------------------------------------------krqkafgyteeele
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNS
PF01645         --------------------------------ikQvasgrFG.vt...eeyLvnakaleikiaQGakpge
PF01645         --------------------------------ikQvasgrFG.vt...eeyLvnakaleikiaQGakpge
PF01645         --------------------------------ikQvasgrFG.vt...eeyLvnakaleikiaQGakpge
PF04898         lllspmaeegkealgsMGdDtplavLsekprllydYFkQlFaqVTNPpiDplREelvmsletnlGkegnl
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEE
PF01645         Ggq-------------------------------------------------------------------
PF01645         Ggq-------------------------------------------------------------------
PF01645         Ggq-------------------------------------------------------------------
PF04898         leeseeqakrlklesPilseeeleklkelee...eelkakeidilfekeegkeg.lekaleelceeaeea
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLG
PF01645         --------pkssikhaGlPlelalaevdqtLvenglrdrvslia.dGglrtgadvvvalllGAdavg---
PF01645         --------pkssikhaGlPlelalaevdqtLvenglrdrvslia.dGglrtgadvvvalllGAdavg---
PF01645         --------pkssikhaGlPlelalaevdqtLvenglrdrvslia.dGglrtgadvvvalllGAdavg---
PF04898         vkeGakiivLsdrkvseervaipallavgavhkhLikkglrtkvslvvetgearevhhfavLigyGasav
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VQFRAEEKFGADADKAFKRFAKAAEKSLMKTMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKT
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         npYlaletleelaekgelkelsaeeavknYkkaiekGllKilskmGistlq-------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           PVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERAEGAGHSYGTTAVRGFVDMTEEKIGFDKGTE
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           NEEALRLLPLNRLEDAFGLNDAAYYHNSFDRLTPDAIDAFEVTPGYRAFSRMMAEERARRPAALRDVLEL
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           PADVTFAGSAEEFRREMGRFCRHGNNSFMVRGLRCDEAADGSFRLQLIGPHGHELARLAALGQSLLDRFD
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           DDIAGHWLEGGALMVQAKGEAFAYMSLIRTAPNSIPLETVQKASEITKTLASGAMSHGALVAAAHEAVAH
PF01645         -------------------------------eplisleevepaleikkriltgamSyGalseeahealak
PF01645         -------------------------------eplisleevepaleikkriltgamSyGalseeahealak
PF01645         -------------------------------eplisleevepaleikkriltgamSyGalseeahealak
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           GTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQLPS
PF01645         amnrlgtksntGEGGedeerlkkakdlaikQvasgrFGvteeyLvn..akaleikiaQGakpgeGgqlpg
PF01645         amnrlgtksntGEGGedeerlkkakdlaikQvasgrFGvteeyLvn..akaleikiaQGakpgeGgqlpg
PF01645         amnrlgtksntGEGGedeerlkkakdlaikQvasgrFGvteeyLvn..akaleikiaQGakpgeGgqlpg
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           PKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGA
PF01645         ekvseeiakiRnikpgvdliSPaphhdiysiedlaqliedLkeinpeakvsvKlvaeagvgtiaagvaka
PF01645         ekvseeiakiRnikpgvdliSPaphhdiysiedlaqliedLkeinpeakvsvKlvaeagvgtiaagvaka
PF01645         ekvseeiakiRnikpgvdliSPaphhdiysiedlaqliedLkeinpeakvsvKlvaeagvgtiaagvaka
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           DVINVAGNTGGTGAAAVTSLKYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGD
PF01645         nadiilidGldGGTGAspkssikhaGlPlelalaevdqtLvenglrdrvsliadGglrtgadvvvalllG
PF01645         nadiilidGldGGTGAspkssikhaGlPlelalaevdqtLvenglrdrvsliadGglrtgadvvvalllG
PF01645         nadiilidGldGGTGAspkssikhaGlPlelalaevdqtLvenglrdrvsliadGglrtgadvvvalllG
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           SFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG
PF01645         AdavgigtaalialgCimarvChtntCpvGvatqdpkLrkrlkfegkpervvnyllvlaeev--------
PF01645         AdavgigtaalialgCimarvChtntCpvGvatqdpkLrkrlkfegkpervvnyllvlaeev--------
PF01645         AdavgigtaalialgCimarvChtntCpvGvatqdpkLrkrlkfegkpervvnyllvlaeev--------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRRENIELGGNRF
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           LNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSVRIDTSGSAGQSFGAFCNDGM
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ---------------------------------------------kkdtgevivrgsaGqsfgaslkggv


                         -         -         -         -         +         -         -:1470
query           IMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDRFAVRNSGAT
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         eltveGdandyvGkgmsgGtIvvkgnagdpdageyvknvsaGdvvlyGatgGkifvegeaGerfgvrnsg


                         -         -         *         -         -         -         -:1540
query           AVVEGVGDFACEYMTNGAVLNLGSFGKGFGNGMSGGFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAI
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         aeivveGnvgdhlgeyMtgGtvvvlGdagrnvGagmsgGtiyvlgeiesgldkkvnleiveee-------


                         +         -         -         -         -         *         -:1610
query           HNQAVHQLLTLHVAETGSAKAAWLLENWESEQHNFAYGMPRALLLYQDSDEILKAKPRKELLEELASALA
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           GYQLRKFKLAYRDRKAVLNGTVPGYGETDTEDMYALINNYTVLSMAQAIALQRLPMASGPSDPAIEKAVR
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           NLILTEDYALMQRLLKYAREALSDHSDQQLAVMIAAKRLDDYKQALARRNIWSVDSPGTYGWIIQQNRKN
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           IEKIGRLPGFEELFAARAIPDLATASSHSRAA--------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------