[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86001.1


[Show Plain Result]

## Summary of Sequence Search
   1::153
  10::153  PF06754 0.0% 48.6111111111111  Phosphonate metabolism protein PhnG 
   1::153


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGGGAPFNLGETT
PF06754         ---------aaRqawlavLaraeaaeleallaalelkpeyellRapeiGlvmvrgriggtGaaFnlGevt


                         -         -         *         -         -         -         -:140
query           VTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAA
PF06754         vtRaavrledgevGysyvlGrdkekaelaAllDallqeeeaaeeleeeviapLaaaqaarraaraaeaaa


                         +         -         -         -         -         *         -:210
query           TRVDFFTMVRGED---------------------------------------------------------
PF06754         tkVdFftlvRGed---------------------------------------------------------