[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86181.1


[Show Plain Result]

## Summary of Sequence Search
   1::299
   2::290  PF00294 0.0% 32.258064516129  pfkB family carbohydrate kinase 
 170::273  PF08543 0.0% 28.8461538461538  Phosphomethylpyrimidine kinase 
 181::285  PF01256 0.0% 23.2323232323232  Carbohydrate kinase 
   1::299


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
PF00294         -iaviGealidliardekl..ekelvevkevekgaGGagaNvavalarLggevafigkvGddkfgeflle
PF08543         ----------------------------------------------------------------------
PF01256         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPA
PF00294         elkkegvdtdyvkideetrtglalvlvdgdgertivfyrgaaadltpeel.nedllaeadvlylsg....
PF08543         ----------------------------------------------------------------------
PF01256         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AAIEAALTAAKAKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
PF00294         llseplpeatlealieaaknngkfdpnlrdplwssaleklrellpkadilkpNeeEaealtgekd...ed
PF08543         -----------------------------eLlplatlvtPNlpEaeaLlgrkikteedmkeaakkllelg
PF01256         ----------------------------------------hkkEfkrLlkaivk.leddrlelarelaqk


                         -         -         -         +         -         -         -:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
PF00294         veevlaalkklkakgaklvvvtlGkkGallvekdgevhvppvpkvkvvDttGAGDafvagflagllagks
PF08543         akavlvkGghlegeeavvtdvlydegeveeleaerietknthGtGCtlsaaiaaelakgksle-------
PF01256         lnavvllkgekdvivspegevlinstgs.salakGGsGDvLaGligalLaqne....asyeaaiaaawlh


                         -         *         -         -         -         -         +:350
query           TRAGAQPSIPQAAEVDAAL---------------------------------------------------
PF00294         leealrlana------------------------------------------------------------
PF08543         ----------------------------------------------------------------------
PF01256         gaasd-----------------------------------------------------------------