[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86197.1


[Show Plain Result]

## Summary of Sequence Search
   1::294
  26::272  PF00696 0.0% 34.6666666666667  Amino acid kinase family 
   1::294


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
PF00696         -------------------------kriVvKlGGssltdkge.lkriaeqiakleedgkklvvVsGggsf


                         -         -         *         -         -         -         -:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
PF00696         tdkllsalgvekggkagerstklktglvaeaqavaslnqdglldevvsagerlsaplvalllkaggisav


                         +         -         -         -         -         *         -:210
query           VIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHAT
PF00696         qrda....................evesndvealkellee.gkvpvltGfigedddgetttlgrgssDtl


                         -         -         -         +         -         -         -:280
query           RLLFLTDVPGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVL
PF00696         aallAaalgAdklilltdVdGvytadPkkvpdakllpeisvdeaeelsiasgdvtgGmkvkh--------


                         -         *         -         -         -         -         +:350
query           LEIFTEGAGTLIVP--------------------------------------------------------
PF00696         ----------------------------------------------------------------------