[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86297.2


[Show Plain Result]

## Summary of Sequence Search
   1::216
   6::118  PF00072 0.0% 33.3333333333333  Response regulator receiver domain 
 151::204  PF00196 0.0% 44.4444444444444  Bacterial regulatory proteins, luxR family 
 148::194  PF08281 0.0% 36.1702127659574  Sigma-70, region 4 
 147::183  PF02796 0.0% 37.8378378378378  Helix-turn-helix domain of resolvase 
 131::190  PF07638 0.0% 25  ECF sigma factor 
   1::216


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNDADLMLLDLAMPGVSGFSGLM
PF00072         -----vlivdDeplvrellrqale.kegyeevaeaddgeealellkekd.pDlillDiempgmdGlellk
PF00196         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------
PF02796         ----------------------------------------------------------------------
PF07638         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDP
PF00072         eireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvkav----------------------
PF00196         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------
PF02796         ----------------------------------------------------------------------
PF07638         ------------------------------------------------------------vdsdspdell


                         +         -         -         -         -         *         -:210
query           DVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKIN
PF00072         ----------------------------------------------------------------------
PF00196         ----------sLskRErevLrllaaGksnkeIAdeLgiSekTVkvhrsnimrKLnvksrvelir------
PF08281         -------alaeLperqreifllryleglsykEIAellgisegtVksrlsRArkk----------------
PF02796         ------GRpsklskndinrvvkLleeGisiskIAkevnisRsT---------------------------
PF07638         eLdealerllsldpeqarlvelrkleGlsveEiAeklgvskrtverrlal--------------------


                         -         -         -         +         -         -         -:280
query           TSAMVA----------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------
PF02796         ----------------------------------------------------------------------
PF07638         ----------------------------------------------------------------------