[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86335.1


[Show Plain Result]

## Summary of Sequence Search
   1::181
  52::155  PF03975 0.0% 48.0769230769231 PF03975 CheD 
   1::181


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVTGGDATRYGVH
PF03975         ---------------------------------------------------mLPessqskkkeesarYgd


                         -         -         *         -         -         -         -:140
query           LMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEF
PF03975         tamelLinellklGarrerleaKlfGGaqmlkkssllniGerNvefvreyLkeegipivaedlggnkgRk


                         +         -         -         -         -         *         -:210
query           WPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEFF-----------------------------
PF03975         iefdpetgkvlvkkl-------------------------------------------------------