[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86457.1


[Show Plain Result]

## Summary of Sequence Search
   1::418
 115::380  PF02353 0.0% 41.6666666666667  Cyclopropane-fatty-acyl-phospholipid synthase 
 177::275  PF08241 0.0% 34.4086021505376  Methyltransferase domain 
 177::273  PF08242 0.0% 24.2105263157895  Methyltransferase domain 
 165::274  PF05175 0.0% 19.2660550458716  Methyltransferase small domain 
   1::418


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASSLHVLLEKIIKIGDLTVNSPGGSRTFGDGTGKKVVLNFTDEAAMQEIAADPALKLAEMYMEGRAKVA
PF02353         ----------------------------------------------------------------------
PF08241         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF05175         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNVAHHYDLSAKLFDLFLDEDWQ
PF02353         --------------------------------------------kevenikahYDlsndffalfldptmt
PF08241         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF05175         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
PF02353         YsCAyferddmtLeeAqlaKldlileklelkpGmtlLdiGcGWGslvrraverydvkvvglTlSkeqakl
PF08241         ------------------------------------LdvGcGtglllealarrpaarvtgvDlseemlat
PF08242         ------------------------------------LeiGcGtGsllrallekqpdieytgvDispsaia
PF05175         ------------------------letlpkklagkvlDlGcGaGvlgaalakespelevtlvDinarAve


                         -         -         -         +         -         -         -:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
PF02353         akqrvdeldlerkvevklldyedlde..kvdrvvsvgafehvgkenydtffkklkkllkedGllllhtit
PF08241         akeraekegle....lvvadaeelpfednsfDvvvsshvlehl..edpekalkeiaRvLkpgGll-----
PF08242         dakeklakrennnnnnvnlealdlldldggssfDvvvasnvlhhl..kdirevldnirklLkp-------
PF05175         sakanleanklen.vevlasdlleeveekkfdlivsNPPfhagkatelevaerliaeAkkhLke------


                         -         *         -         -         -         -         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
PF02353         slhkkelaerglklkfidkeiFPgGelpsieeieeeiseagftvvdveslrahYakTLkaWaealqenkd
PF08241         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF05175         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQNEAKLLEFEKTRPPLEKVSF--
PF02353         eaialvseevarmyelYLagcaeaFrkgyi----------------------------------------
PF08241         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF05175         ----------------------------------------------------------------------