[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86489.1


[Show Plain Result]

## Summary of Sequence Search
   1::163
  24::104  PF07681 0.0% 44.4444444444444 PF07681 DoxX 
   1::163


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLIGDTPITYRRYSMSSSQNALVLIARILLSFIFIYSGFGKLTDPAGTAGMIAGAGMPAATALAYLAGL
PF07681         -----------------------llllRlllgvlFiahGlqklfgfglegtaaslaalglpppellayla


                         -         -         *         -         -         -         -:140
query           FELVAGLAILAGFQTKIAAWALAVFCVFTGLVFHSGTVAVPGWPEPALGWINTLNGIMMMKNITLAGAYI
PF07681         alvElvgglllllGlltRlaAlglavtllvaill------------------------------------


                         +         -         -         -         -         *         -:210
query           LLATFGAGAYSVDAKRGFVAARA-----------------------------------------------
PF07681         ----------------------------------------------------------------------