[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86566.1


[Show Plain Result]

## Summary of Sequence Search
   1::272
  25::179  PF00106 0.0% 20.8053691275168  short chain dehydrogenase 
  67::100  PF12241 0.0% 26.4705882352941  Trans-2-enoyl-CoA reductase catalytic region 
 104::132  PF12241 0.0% 21.4285714285714  Trans-2-enoyl-CoA reductase catalytic region 
 136::203  PF12241 0.0% 26.4705882352941  Trans-2-enoyl-CoA reductase catalytic region 
   1::272


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
PF00106         ------------------------GlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvva
PF12241         ------------------------------------------------------------------gDaF
PF12241         ------------------------------------------------------------------gDaF
PF12241         ------------------------------------------------------------------gDaF


                         -         -         *         -         -         -         -:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
PF00106         cDvadrdalaallaeirkelgpldgvvhaagvld.dglleel...tperlervlapkvtgawllheltld
PF12241         sdevkekvielikedlgkvdlvvYSlAapr---vkekvielikedl.gkvdlvvYSlAaprr---gvlae
PF12241         sdevkekvielikedlgkvdlvvYSlAapr---vkekvielikedl.gkvdlvvYSlAaprr---gvlae
PF12241         sdevkekvielikedlgkvdlvvYSlAapr---vkekvielikedl.gkvdlvvYSlAaprr---gvlae


                         +         -         -         -         -         *         -:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYIL
PF00106         ..adlgafvlfSSvagvlgspgqaaYaaakaaldalaes-------------------------------
PF12241         gaktvaysYiGeeltapiYregtiGkAKkdlektakalneklaklggkayvsvlkalvTqass-------
PF12241         gaktvaysYiGeeltapiYregtiGkAKkdlektakalneklaklggkayvsvlkalvTqass-------
PF12241         gaktvaysYiGeeltapiYregtiGkAKkdlektakalneklaklggkayvsvlkalvTqass-------


                         -         -         -         +         -         -         -:280
query           KWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD--------
PF00106         ----------------------------------------------------------------------
PF12241         ----------------------------------------------------------------------
PF12241         ----------------------------------------------------------------------
PF12241         ----------------------------------------------------------------------