[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86654.1


[Show Plain Result]

## Summary of Sequence Search
   1::140
  40::135  PF02566 0.0% 31.1111111111111  OsmC-like protein 
   1::140


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
PF02566         ---------------------------------------gs.gpsPeelllaalasClaitlravaakkg


                         -         -         *         -         -         -         -:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSVA
PF02566         ikl.esleveveg....erdpegfrfeeirlkvevkldgadeeeklkrllekaekrCpvsntlkn-----