[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86734.2


[Show Plain Result]

## Summary of Sequence Search
   1::435
 122::407  PF00144 0.0% 25.4826254826255 PF00144 Beta-lactamase 
   1::435


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLAAVLPVLVFPHGASSQVATPLSAEQSDPLKLGWMQGFPPPEDKIIRFSDSDYFNFPKSRWTVCHFRQL
PF00144         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTDGIVVLHKGVLVYERYSGCLN
PF00144         ---------------------------------------------------vavtrdgkvvldkgggvad


                         +         -         -         -         -         *         -:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
PF00144         lesgrpvtadtlfriaSvtKtftaaavlqlveeGkldLddpVskylPefagpgkgkiTlrdLltHtsGlp


                         -         -         -         +         -         -         -:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
PF00144         dyfasdlleeaaada..................aellralatlppkyapGtkwgYsntgygllgellekv


                         -         *         -         -         -         -         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
PF00144         tgqsleellreeilrpLgmkdtelgppesgdprdaagytgngpearappanlpaeaegagglistardla


                         -         -         -         -         *         -         -:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPVASNAANDPTSLPA
PF00144         rflgllleggsllsakqlaql.taklssgttrpagiragl........glGwvladk-------------


                         -         -         +         -         -         -         -:490
query           YEAVARYLMGGAARP-------------------------------------------------------
PF00144         ----------------------------------------------------------------------