[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK86736.1


[Show Plain Result]

## Summary of Sequence Search
   1::757
 142::306  PF00912 0.0% 52.7272727272727  Transglycosylase 
 396::664  PF00905 0.0% 28.957528957529  Penicillin binding protein transpeptidase domain 
   1::757


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVLRREWVETQKYRRAALPRTGKHRQVQEEKDDNKGRRKRHILLRIDSFIDSGLWTAAARLVDFWEDVTI
PF00912         ----------------------------------------------------------------------
PF00905         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASRKLHVRGWKKLVVNLTCDALTFGTAGSIVLLALAMPAFEETKKDWRYRGDFAVTFLDRYGNTIGHRGI
PF00912         ----------------------------------------------------------------------
PF00905         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
PF00912         -nreyvsldeippalvqavvaiEDrrFyehkGvdlkgiarallsnlksgkksqGgSTitqqlaknlflse
PF00905         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMGGGTFGAAAAAQFYFGKNLTDVTLSESAILAGLF
PF00912         ertlsrKlkeailAlklekklskdeilelYlnsvylgrgvyGieaAarayFgksasdLtlaeaalLagll
PF00905         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRL
PF00912         kaPsrynplknperakkrrnvvlerm--------------------------------------------
PF00905         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAEGKFKDHTVVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
PF00912         ----------------------------------------------------------------------
PF00905         ---------------------------------------------vvvldpktgevlamaskpsydpnrk


                         -         -         +         -         -         -         -:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
PF00912         ----------------------------------------------------------------------
PF00905         dknepllnravqgtyePGStfKvvtaaaalengilkpeetfddssglkvggktikdwnktgegtitlrea


                         *         -         -         -         -         +         -:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
PF00912         ----------------------------------------------------------------------
PF00905         lekSsntyfvqlaqklgkdk.lrkylkkfglGnktgidlpgesagkvpkreekgdsattaigqgsltvtp


                         -         -         -         *         -         -         -:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
PF00912         ----------------------------------------------------------------------
PF00905         lqmaqayaaiangGklvkPhlvkaivdpdgkta..eikpkklgklpisketaekvkealkgvvskg.ag.


                         -         +         -         -         -         -         *:700
query           NYTTAVWFGNDEFTPMNNMTGGALPAMTYKRLMDYAHQGMELRPIPGIQNLLPTGARPQPSAQVAAASAT
PF00912         ----------------------------------------------------------------------
PF00905         aaavagykvagKTGTAevagkkgekdnktyngwf------------------------------------


                         -         -         -         -         +         -         -:770
query           TAPAMPALTRPRSLSAEATRVIRSIAKTMKEAPPLAVTTQKVAEATIRDGRDEAGRR-------------
PF00912         ----------------------------------------------------------------------
PF00905         ----------------------------------------------------------------------