[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87067.1


[Show Plain Result]

## Summary of Sequence Search
   1::396
 122::396  PF00346 0.0% 59.1911764705882  Respiratory-chain NADH dehydrogenase, 49 Kd subunit 
   1::396


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
PF00346         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
PF00346         ---------------------------------------------------DvGaltPllyaFeeRekly


                         +         -         -         -         -         *         -:210
query           VFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLE
PF00346         dlyeavsGaRlhaayfrigGvaqDlplglldkleefldsflkrvdeyeklltenrifkeRlegvgivtae


                         -         -         -         +         -         -         -:280
query           DAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRL
PF00346         dalnwglsGvmlRgsGikwDlRkvqpYelYdefdfdvpvgkegDcydRyllrveelReslkiikqalnkl


                         -         *         -         -         -         -         +:350
query           SGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSN
PF00346         pagp...gekveakklkkpkkaelkesietliahfklysegfkvpagesyaavEapkGelgvylvsdgse


                         -         -         -         -         *         -         -:420
query           KPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR------------------------
PF00346         lpyRlkirapdFahlqlldallrgvllaDvvailgsiDivfgevDR------------------------