[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87211.2


[Show Plain Result]

## Summary of Sequence Search
   1::306
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGWSSFWDNSGADGDVVRSSNILAGWSIEVMPRTAAKIDDFRNILPDGTRVYIAHIDGTPIADMVSTAKR


                         -         -         *         -         -         -         -:140
query           LHDEGFPVMPHLPARGISGKNELEDWLKRYQGEAGVTQALLLGGGQKQPAGSFSSSIDMIETGLFDKMGF


                         +         -         -         -         -         *         -:210
query           THLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIP


                         -         -         -         +         -         -         -:280
query           VHVGIAGPTKLQTLIKFAIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAANPDSLIEHVHI


                         -         *         -         -         -         -         +:350
query           FPLGGIKPSAEWMKKHASTGTLANVA--------------------------------------------