[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87226.2


[Show Plain Result]

## Summary of Sequence Search
   1::82
  34::82   PF04226 0.0% 43.75  Transglycosylase associated protein 
   1::82


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESVGWIAAIIIGGLAGWLAGKLMDMRFGIFMNIILGIVGSVVAVAVLRTLDVFVQDSRLGYFVTSFLGA
PF04226         ---------------------------------IilGivGAfvGgfllgllGi.vaggelaglivaiiGA


                         -         -         *         -         -         -         -:140
query           SLLLFVAKLVRR----------------------------------------------------------
PF04226         viLLfivrlvrr----------------------------------------------------------