[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87429.2


[Show Plain Result]

## Summary of Sequence Search
   1::228
  28::194  PF00881 0.0% 31.9018404907975  Nitroreductase family 
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQANPFDHALSPARPFSGAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
PF00881         ---------------------------iksRrSiR.kFddepvpkedlekileaarlaPsagnlqpwrfv


                         -         -         *         -         -         -         -:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
PF00881         vitdeelkerlaklaaealakaeaqaelllryr.kkgnqklladapvlivv..srtkdkkerksddrsye


                         +         -         -         -         -         *         -:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGW
PF00881         yalldaglaaqnlllaAaalGlgscpiggfdeeeevrelLglpdeeeivllial----------------


                         -         -         -         +         -         -         -:280
query           RQRVPLEELVFRNRWGGR----------------------------------------------------
PF00881         ----------------------------------------------------------------------