[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87597.2


[Show Plain Result]

## Summary of Sequence Search
   1::417
  34::328  PF00579 0.0% 37.8091872791519  tRNA synthetases class I (W and Y) 
 355::395  PF01479 0.0% 36.5853658536585  S4 domain 
   1::417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
PF00579         ---------------------------------rplrvysGidPTgk.lHlGylvplkklvqlqkagyev
PF01479         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
PF00579         ffliaDltAligdps.kaeerklrkreeelena..ikaqlakgldpekae....ivlnsdwleklelael
PF01479         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
PF00579         lrdlgklgelnrmlqfksvkkrlkqnegislgeftYplLqaaDilllkad....lvpgGsDQkqhielgr
PF01479         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DLGHRMGTPQLYALTSPLLTTSSGAKMGKSASGAVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLP
PF00579         elarrfnkkvfkkpvgltvplltgldGekKmSKSagnsaIfLddekesvkkkiqkavtdsdeevekllkl
PF01479         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MDEIARIATLGGSEINEAKKILATEVTAILHGRAAAEEAAETARKTFEEGALAENLPSIEVPTSELDAGV
PF00579         ktelsnelierleaelgkkpkkeaeellaeevtklvhggdlkkalaea----------------------
PF01479         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GVLSLIVRAGLASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVTGDGVIKLSVGKKKHVLVRPA---
PF00579         ----------------------------------------------------------------------
PF01479         ----vLarlglassrseArqlIehGhVrVNGkvvkdpsyrVkpgD-------------------------