[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87761.1


[Show Plain Result]

## Summary of Sequence Search
   1::200
   3::61   PF00226 0.0% 47.4576271186441  DnaJ domain 
 133::177  PF00226 0.0% 33.3333333333333  DnaJ domain 
   1::200


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPQLA
PF00226         --dyYeiLgvpkdasdeeIkkaYrklalkyHPDknkddeeeaeekfkeineAyevLsdpek---------
PF00226         --dyYeiLgvpkdasdeeIkkaYrklalkyHPDknkddeeeaeekfkeineAyevLsdpek---------


                         -         -         *         -         -         -         -:140
query           DAKDLKGLLMLETLVNEFILDEREPGSFDPVAAMRRKLTDDILKSRFHILELERHRTRVRKHMDRLGRKP
PF00226         --------------------------------------------------------------e.......
PF00226         --------------------------------------------------------------e.......


                         +         -         -         -         -         *         -:210
query           ETDVLSSMLRARSQSIAEAIRNAETQIEAIEQAYTMLEGYSYELETVTLAEPLLKGEAAE----------
PF00226         ....................eeaeekfkeineAyevL---------------------------------
PF00226         ....................eeaeekfkeineAyevL---------------------------------