[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87844.1


[Show Plain Result]

## Summary of Sequence Search
   1::378
 187::351  PF04101 0.0% 37.1951219512195  Glycosyltransferase family 28 C-terminal domain 
   6::141  PF03033 0.0% 37.6923076923077  Glycosyltransferase family 28 N-terminal domain 
   1::378


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
PF04101         ----------------------------------------------------------------------
PF03033         -----vvlaggGTrGdvePavAlareLqrrGheVrlatppgleefv...eeagleavp...igpdvklwa


                         -         -         *         -         -         -         -:140
query           VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKA
PF04101         ----------------------------------------------------------------------
PF03033         kleslktlkelaeglkalrkakeilkeakpdvvvgfggyvadlaliaallagipanvaEqngipglvnkl


                         +         -         -         -         -         *         -:210
query           IAGGFLPPANGQYSEKTVATGNPVRPAVLAASEIPYTPSQTGETFQLVVFGGSQGAQFFSSAVPAAICLM
PF04101         ----------------------------------------------ifVtgGSqgaealnqlvleilkll
PF03033         l---------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KDEQRKRIVVTQQARPEDKDSVIASYQKLGVKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRP
PF04101         elk.sreeqvlhqtGksnyeevkikveklglkvevfsysdkmaeiikaadlvIsrAGagtiaellalgkp
PF03033         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SILVPYPHALDHDQAANAAALSAAGGASVIKQAELSPQKLSSLLSSALAEPDRLSATAAAAKATGKPHAA
PF04101         lIlvPlpeaaenhqdnnakelakagagrvllqkeltpekLeeallelaaekkrlaekskaaaaarfadli
PF03033         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DVLADLVEAIAEGRSVQEFKKKNEGVGA------------------------------------------
PF04101         e---------------------------------------------------------------------
PF03033         ----------------------------------------------------------------------