[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87903.2


[Show Plain Result]

## Summary of Sequence Search
   1::415
  41::392  PF07221 0.0% 42.3188405797101  N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) 
   1::415


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPEDDHNSRNWNTLPWHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVRGIHASARMVH
PF07221         ----------------------------------------Gffeeldadgqvldadk..rrivlqaRqvy


                         -         -         *         -         -         -         -:140
query           CFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGH
PF07221         vFavaanlgrpgwleaaehgleflekvlrdaehggwfsalddggvldatkdlYnhaFvllAlaqalaagk


                         +         -         -         -         -         *         -:210
query           PLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAE
PF07221         peakelldealavlekrfwdeehglyeeeldedwskl...rgqnpnMhlleAfLalaevtgdeewlerad


                         -         -         -         +         -         -         -:280
query           RIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMP
PF07221         eiaelalsrfadeesgllrEhfdedwnvlpdvngedlfegrlvePGHqfEwawLlldlaerarrraaell


                         -         *         -         -         -         -         +:350
query           VAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIW
PF07221         .ekAkalfatavakgwdkdrgglvytldregkpldddkllWvqaEalkaaaalael.tgeekylewyerl


                         -         -         -         -         *         -         -:420
query           STIANNFIDHENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIKESGGDY-----
PF07221         aaylrrhlidpekGlWydkldedgevaeklpagkskfYHllg----------------------------