[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for atum0:AAK87977.1


[Show Plain Result]

## Summary of Sequence Search
   1::155
  10::110  PF01575 0.0% 30.6818181818182  MaoC like domain 
   1::155


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
PF01575         ---------gepvdfekpvtvteadielfAlvsgDlnPiHvdpefAklagfggpIahGmltlaivralve


                         -         -         *         -         -         -         -:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIWLNITFNEGVNQS
PF01575         eqladn.............vvarlgewkvrFtkpVlpgdt------------------------------


                         +         -         -         -         -         *         -:210
query           GETVLTFQSGVLEFD-------------------------------------------------------
PF01575         ----------------------------------------------------------------------